


| Basic Information | |
|---|---|
| Family ID | F089783 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 67.59 % |
| % of genes near scaffold ends (potentially truncated) | 23.15 % |
| % of genes from short scaffolds (< 2000 bps) | 79.63 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.926 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (34.259 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.630 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (89.815 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 11.94% Coil/Unstructured: 83.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF09694 | Gcw_chp | 17.59 |
| PF00313 | CSD | 6.48 |
| PF00543 | P-II | 5.56 |
| PF01541 | GIY-YIG | 2.78 |
| PF00149 | Metallophos | 2.78 |
| PF00909 | Ammonium_transp | 2.78 |
| PF03401 | TctC | 1.85 |
| PF13609 | Porin_4 | 1.85 |
| PF02915 | Rubrerythrin | 1.85 |
| PF04055 | Radical_SAM | 1.85 |
| PF01503 | PRA-PH | 1.85 |
| PF02585 | PIG-L | 0.93 |
| PF07460 | NUMOD3 | 0.93 |
| PF00202 | Aminotran_3 | 0.93 |
| PF00196 | GerE | 0.93 |
| PF00691 | OmpA | 0.93 |
| PF02777 | Sod_Fe_C | 0.93 |
| PF04820 | Trp_halogenase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 5.56 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 2.78 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.85 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.93 % |
| All Organisms | root | All Organisms | 49.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c008611 | Not Available | 1899 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c016446 | Not Available | 1186 | Open in IMG/M |
| 3300002092|JGI24218J26658_1022332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300002098|JGI24219J26650_1011399 | Not Available | 1443 | Open in IMG/M |
| 3300002408|B570J29032_109928418 | Not Available | 2955 | Open in IMG/M |
| 3300003860|Ga0031658_1046981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300004095|Ga0007829_10018158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1351 | Open in IMG/M |
| 3300004095|Ga0007829_10082118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300004096|Ga0066177_10218374 | Not Available | 787 | Open in IMG/M |
| 3300004481|Ga0069718_15953852 | Not Available | 670 | Open in IMG/M |
| 3300004684|Ga0065168_1002007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3385 | Open in IMG/M |
| 3300004685|Ga0065177_1003055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3035 | Open in IMG/M |
| 3300004685|Ga0065177_1017410 | Not Available | 1346 | Open in IMG/M |
| 3300004686|Ga0065173_1012878 | Not Available | 1542 | Open in IMG/M |
| 3300004686|Ga0065173_1089844 | Not Available | 552 | Open in IMG/M |
| 3300004770|Ga0007804_1017963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1991 | Open in IMG/M |
| 3300004773|Ga0007795_10190526 | Not Available | 571 | Open in IMG/M |
| 3300004774|Ga0007794_10013610 | Not Available | 2421 | Open in IMG/M |
| 3300004774|Ga0007794_10160348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300004805|Ga0007792_10037720 | Not Available | 1465 | Open in IMG/M |
| 3300004805|Ga0007792_10071561 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300005580|Ga0049083_10226313 | Not Available | 633 | Open in IMG/M |
| 3300006071|Ga0007876_1011261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2570 | Open in IMG/M |
| 3300006071|Ga0007876_1082665 | Not Available | 841 | Open in IMG/M |
| 3300006072|Ga0007881_1011023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2727 | Open in IMG/M |
| 3300006072|Ga0007881_1034189 | Not Available | 1362 | Open in IMG/M |
| 3300006101|Ga0007810_1038032 | Not Available | 1032 | Open in IMG/M |
| 3300006101|Ga0007810_1066924 | Not Available | 718 | Open in IMG/M |
| 3300006113|Ga0007858_1008302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2574 | Open in IMG/M |
| 3300006120|Ga0007867_1004350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3621 | Open in IMG/M |
| 3300006123|Ga0007852_1002847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7 | 4223 | Open in IMG/M |
| 3300006123|Ga0007852_1136600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300006128|Ga0007828_1055325 | Not Available | 824 | Open in IMG/M |
| 3300009068|Ga0114973_10539320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300009151|Ga0114962_10094771 | All Organisms → Viruses → Predicted Viral | 1868 | Open in IMG/M |
| 3300009151|Ga0114962_10270311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300009151|Ga0114962_10475520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300009151|Ga0114962_10712122 | Not Available | 512 | Open in IMG/M |
| 3300009152|Ga0114980_10422819 | Not Available | 763 | Open in IMG/M |
| 3300009154|Ga0114963_10496714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300009159|Ga0114978_10194620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1284 | Open in IMG/M |
| 3300009159|Ga0114978_10628675 | Not Available | 618 | Open in IMG/M |
| 3300009159|Ga0114978_10709963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300009160|Ga0114981_10160849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1237 | Open in IMG/M |
| 3300009160|Ga0114981_10309972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300009161|Ga0114966_10182364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
| 3300009161|Ga0114966_10315498 | Not Available | 941 | Open in IMG/M |
| 3300009168|Ga0105104_10498470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300009180|Ga0114979_10180672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1284 | Open in IMG/M |
| 3300009181|Ga0114969_10015842 | Not Available | 5400 | Open in IMG/M |
| 3300009182|Ga0114959_10447720 | Not Available | 628 | Open in IMG/M |
| 3300009183|Ga0114974_10115865 | Not Available | 1708 | Open in IMG/M |
| 3300009183|Ga0114974_10124271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1637 | Open in IMG/M |
| 3300009183|Ga0114974_10572608 | Not Available | 625 | Open in IMG/M |
| 3300009184|Ga0114976_10649091 | Not Available | 532 | Open in IMG/M |
| 3300009502|Ga0114951_10044377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2726 | Open in IMG/M |
| 3300009502|Ga0114951_10458556 | Not Available | 627 | Open in IMG/M |
| 3300010157|Ga0114964_10294151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300010158|Ga0114960_10136396 | Not Available | 1331 | Open in IMG/M |
| 3300010158|Ga0114960_10148468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1262 | Open in IMG/M |
| 3300010158|Ga0114960_10165176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
| 3300010160|Ga0114967_10007119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8702 | Open in IMG/M |
| 3300010388|Ga0136551_1098601 | Not Available | 509 | Open in IMG/M |
| 3300010885|Ga0133913_10456256 | Not Available | 3372 | Open in IMG/M |
| 3300011184|Ga0136709_1004967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1944 | Open in IMG/M |
| 3300013006|Ga0164294_10553078 | Not Available | 782 | Open in IMG/M |
| 3300013094|Ga0164297_10123849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300016726|Ga0182045_1204556 | Not Available | 604 | Open in IMG/M |
| 3300020048|Ga0207193_1006148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18494 | Open in IMG/M |
| 3300020162|Ga0211735_11273265 | Not Available | 871 | Open in IMG/M |
| 3300020718|Ga0214178_1045435 | Not Available | 534 | Open in IMG/M |
| 3300021138|Ga0214164_1021610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1796 | Open in IMG/M |
| 3300021354|Ga0194047_10060948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1685 | Open in IMG/M |
| 3300021354|Ga0194047_10218914 | Not Available | 750 | Open in IMG/M |
| 3300021354|Ga0194047_10276719 | Not Available | 647 | Open in IMG/M |
| 3300021519|Ga0194048_10000938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14401 | Open in IMG/M |
| 3300021519|Ga0194048_10317203 | Not Available | 559 | Open in IMG/M |
| 3300022555|Ga0212088_10131227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2179 | Open in IMG/M |
| 3300022555|Ga0212088_10673626 | Not Available | 621 | Open in IMG/M |
| 3300023184|Ga0214919_10001214 | Not Available | 42902 | Open in IMG/M |
| 3300025091|Ga0209616_1010097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
| 3300025357|Ga0208383_1025533 | Not Available | 692 | Open in IMG/M |
| 3300025382|Ga0208256_1049362 | Not Available | 579 | Open in IMG/M |
| 3300025410|Ga0208875_1028814 | Not Available | 918 | Open in IMG/M |
| 3300025413|Ga0208614_1064046 | Not Available | 533 | Open in IMG/M |
| 3300025437|Ga0208742_1062473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300025449|Ga0208106_1000145 | Not Available | 27645 | Open in IMG/M |
| 3300025466|Ga0208497_1029360 | Not Available | 1195 | Open in IMG/M |
| 3300025466|Ga0208497_1034358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1077 | Open in IMG/M |
| 3300025590|Ga0209195_1014555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2691 | Open in IMG/M |
| 3300025723|Ga0208741_10016151 | Not Available | 1888 | Open in IMG/M |
| 3300027708|Ga0209188_1000114 | Not Available | 92673 | Open in IMG/M |
| 3300027708|Ga0209188_1012955 | Not Available | 4594 | Open in IMG/M |
| 3300027733|Ga0209297_1190269 | Not Available | 820 | Open in IMG/M |
| 3300027734|Ga0209087_1048907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1940 | Open in IMG/M |
| 3300027734|Ga0209087_1113974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
| 3300027736|Ga0209190_1107651 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
| 3300027749|Ga0209084_1328752 | Not Available | 567 | Open in IMG/M |
| 3300027754|Ga0209596_1073132 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1697 | Open in IMG/M |
| 3300027777|Ga0209829_10313265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300027782|Ga0209500_10166275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
| 3300027892|Ga0209550_10354694 | Not Available | 923 | Open in IMG/M |
| 3300027896|Ga0209777_10299821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
| 3300027899|Ga0209668_10001717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9484 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1264135 | Not Available | 594 | Open in IMG/M |
| 3300031746|Ga0315293_10931915 | Not Available | 625 | Open in IMG/M |
| 3300031857|Ga0315909_10224143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1467 | Open in IMG/M |
| 3300032605|Ga0316232_1142038 | Not Available | 1022 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 34.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 31.48% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 4.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.70% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.85% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.85% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.85% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.93% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.93% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.93% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025449 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0086112 | 3300000176 | Freshwater | MTVNQANLVNAKASTGEVTVSGKNVKFSARTAKADSFAV* |
| TB03JUN2009E_0164462 | 3300000176 | Freshwater | MTVNQAKSVNANANTGEVTVSGKNVKFSARSVKRQSLAV* |
| JGI24218J26658_10223321 | 3300002092 | Lentic | MTVNQATLVNANANTGEVTVSGKGVKFSARTAQRQSLAV* |
| JGI24219J26650_10113991 | 3300002098 | Lentic | TTWSKTQKTLNANASKGEVTVSGKNIKFSARTAQRQSLAV* |
| B570J29032_1099284184 | 3300002408 | Freshwater | MTVNQANLVNAKANTGEVTVSGKNVKFSTRSVKRQSLAV* |
| Ga0031658_10469811 | 3300003860 | Freshwater Lake Sediment | MTVNQAKLVNAKASTGEVTVSGKGVKFSARTAKAESFAV* |
| Ga0007829_100181581 | 3300004095 | Freshwater | MTVNQANLVNAKANTGEVTVSGKNIKFSARSAQRQSLAV* |
| Ga0007829_100821182 | 3300004095 | Freshwater | MTVNQAKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV* |
| Ga0066177_102183742 | 3300004096 | Freshwater Lake | MTVNQANLVNAKANTGEVTVSGKNIKFSARSVKRQSFAV* |
| Ga0069718_159538522 | 3300004481 | Sediment | MTVNQANYVNAKTSTGEVTVSGKNVKFSARSAQRQSLAV* |
| Ga0065168_10020071 | 3300004684 | Freshwater | MTVNQAKLVNANANTGEVAVSGKNIKFSARTVRATSFAV* |
| Ga0065177_10030557 | 3300004685 | Freshwater | MTVNQAKNLNANASKGEVTVSGKGIRFSARTAQRQTLAV* |
| Ga0065177_10174101 | 3300004685 | Freshwater | MTLNQAKLVNANANTKSGTVTVNGKGVKFSARTAKVALV* |
| Ga0065173_10128781 | 3300004686 | Freshwater | MTVNQAKSVNANANTGEVTVSGKNVKFSARSVKSQSLAV* |
| Ga0065173_10898441 | 3300004686 | Freshwater | MTVNQAKLVNANANTGEVTVSAKNLKFRTLAAKGQSLAV* |
| Ga0007804_10179633 | 3300004770 | Freshwater | MIVNQANLVNAKASTGEVTVSGKNIKFRTLAAKGQSLAV* |
| Ga0007795_101905262 | 3300004773 | Freshwater | MTVNQAKLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV* |
| Ga0007794_1001361010 | 3300004774 | Freshwater | MILNQANLVNAKASTGEVTVSGKNVKFSARSVKAESFAV* |
| Ga0007794_101603481 | 3300004774 | Freshwater | MTVNQAKLVNAKASTGEVTVSGKNVKFSARSAQRQSLAV* |
| Ga0007792_100377203 | 3300004805 | Freshwater | MILNQAKLVNANANTGEVTVSGKNVKFSARTAQRQSLAV* |
| Ga0007792_100715613 | 3300004805 | Freshwater | MTVNQATYVNAKANTGEVTVSGKNVKFSARSAQRQSLAV* |
| Ga0049083_102263131 | 3300005580 | Freshwater Lentic | MTVNQANLVNAKANTGEVTVSGKNIKFSTRSVKRQSFAV* |
| Ga0007876_10112615 | 3300006071 | Freshwater | MTVNQANKVNANANTTVTVSGKNIKFSARAAKESLAV* |
| Ga0007876_10826652 | 3300006071 | Freshwater | MTVNQANLVNAKANTGEVTVSGKNVKFSARTAQRQSLAV* |
| Ga0007881_10110232 | 3300006072 | Freshwater | MTVNQANLVNAKASTGEVTVSGKGVKFSARTAKAESFAV* |
| Ga0007881_10341893 | 3300006072 | Freshwater | AKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV* |
| Ga0007810_10380322 | 3300006101 | Freshwater | EAKLVNANANTGEVTVSGKNIKFSARSAQRQSLAV* |
| Ga0007810_10669242 | 3300006101 | Freshwater | MILNQAKLVNAKASTGEVTVSGKGVKFSARTVKAESFAV* |
| Ga0007858_10083021 | 3300006113 | Freshwater | NQAKLVNANANTKSGTVTVNGKGVKFSARTAKVALV* |
| Ga0007867_10043502 | 3300006120 | Freshwater | MTVNQANLVNANANTTVTVSGKNIKFSARAAKESLAV* |
| Ga0007852_10028475 | 3300006123 | Freshwater | MTVNQAKLVNANANTGEVTVSGKNVKFSARSAKATLAV* |
| Ga0007852_11366001 | 3300006123 | Freshwater | LGQPVEEANLVNAKASTGEVTFSAKNVKFRALTAKAESFAV* |
| Ga0007828_10553252 | 3300006128 | Freshwater | MTVNQAKLVNANANTGEVTVSGKNIKFSARSAQRQSLAV* |
| Ga0114973_105393201 | 3300009068 | Freshwater Lake | MTANQAKLVNAKASTGEVTVSGKNLKFRTLAAKGQSLAV* |
| Ga0114962_100947713 | 3300009151 | Freshwater Lake | MTVNQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV* |
| Ga0114962_102703111 | 3300009151 | Freshwater Lake | MTVNQANLVNATASTGEVTVKANKGIRFSARSTAKAEAFAV* |
| Ga0114962_104755202 | 3300009151 | Freshwater Lake | MTVNQAKLVNANANTGEVTVSGKNVKFRTLAAKGQLLAV* |
| Ga0114962_107121221 | 3300009151 | Freshwater Lake | MTVNQANLVNAKASTGEVTVSAKNIKFRTLAAKGQSLAV* |
| Ga0114980_104228192 | 3300009152 | Freshwater Lake | MTVNQAKLVNAKANTGEVTVSGKNVKFSARTAQRQSLAV* |
| Ga0114963_104967142 | 3300009154 | Freshwater Lake | AMTVNQAKLVNANANTGEVTVSGKNLKFSARTVKAESFAV* |
| Ga0114978_101946201 | 3300009159 | Freshwater Lake | MTVNQAKLVNAKANTGEVTVSGKNVKFSTRAVKRQTLAV* |
| Ga0114978_106286751 | 3300009159 | Freshwater Lake | QAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV* |
| Ga0114978_107099631 | 3300009159 | Freshwater Lake | MTANQAKLVNAKASTGEVTVSAKNLKFRTLAAKGQSLAV* |
| Ga0114981_101608491 | 3300009160 | Freshwater Lake | MTVNQAKLVNAKANTGEVTVSGKNVKFSARTAQRQS |
| Ga0114981_103099721 | 3300009160 | Freshwater Lake | QAKLVNAKANTGEVTVSGKNVKFSARTAQRQSLAV* |
| Ga0114966_101823643 | 3300009161 | Freshwater Lake | MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV* |
| Ga0114966_103154981 | 3300009161 | Freshwater Lake | NQANQVNAKASTGEVTVSGKNVKFSARTVKAESFAV* |
| Ga0105104_104984701 | 3300009168 | Freshwater Sediment | MTVNQANYVNAKTSTGEVTVSGKNVKFSARTAKATLAV* |
| Ga0114979_101806721 | 3300009180 | Freshwater Lake | MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLSV* |
| Ga0114969_1001584213 | 3300009181 | Freshwater Lake | MILNQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV* |
| Ga0114959_104477202 | 3300009182 | Freshwater Lake | NQAKIVNANANTTVTVSGKNVKFKARTAKASLAV* |
| Ga0114974_101158651 | 3300009183 | Freshwater Lake | MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQS |
| Ga0114974_101242712 | 3300009183 | Freshwater Lake | MTVNQANFVNAKTSTGEVTVSGKNVKFSARSAQRQSLAV* |
| Ga0114974_105726081 | 3300009183 | Freshwater Lake | MTVNQAKLVNAKASTGEVTVSGKNVKFSARTVKAESFAV |
| Ga0114976_106490912 | 3300009184 | Freshwater Lake | MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQ |
| Ga0114951_100443778 | 3300009502 | Freshwater | MTVNQANLVNAKASTGEVTVSAKNLKFRTLAAKGQSLAV* |
| Ga0114951_104585561 | 3300009502 | Freshwater | MTVNQANLVNAKANTGEVTVSGKGVKFSARTAKAESFAV* |
| Ga0114964_102941511 | 3300010157 | Freshwater Lake | NQANLVNANANTGEVTVSGKNVKFRTLAAKGQTLAV* |
| Ga0114960_101363966 | 3300010158 | Freshwater Lake | MTANQANQVNAKASTGEVTVSGKNVKFSARTVKAESFAV* |
| Ga0114960_101484681 | 3300010158 | Freshwater Lake | NQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV* |
| Ga0114960_101651763 | 3300010158 | Freshwater Lake | MTANQANQVNAKASTGEVTVSGKGVKFSARTVKAESFAV |
| Ga0114967_1000711913 | 3300010160 | Freshwater Lake | MTVNQANLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV* |
| Ga0136551_10986011 | 3300010388 | Pond Fresh Water | MTVNQANLVNAKANTGEVTVSGKGVKFSARTAKATLAV* |
| Ga0133913_104562565 | 3300010885 | Freshwater Lake | LNQAKIVNANANTTVTVSGKNVKFKARTAKASLAV* |
| Ga0136709_10049673 | 3300011184 | Freshwater | MTVNQAKLVNAKASTGEVTVSGKNVKFSARTAKAESFAV* |
| Ga0164294_105530782 | 3300013006 | Freshwater | MTVNQANKVNAKTSTGEVTVSGKNVKFSARAVKATSFAV* |
| Ga0164297_101238491 | 3300013094 | Freshwater | VEANLVNAKASTGEVTVSGKNIKFRTLAAKGQSLAV* |
| Ga0182045_12045561 | 3300016726 | Salt Marsh | MTVNQANLVNAKANTGEVTVSGKNVKFSARTAQRQS |
| Ga0207193_10061486 | 3300020048 | Freshwater Lake Sediment | MTVNQATYVNAKTSTGEVTVSGKNVKFRTLAAKGQSLAV |
| Ga0211735_112732652 | 3300020162 | Freshwater | MTVNQANKVNAKTSTGEVTVSGKNIKFSARTVKAESFAV |
| Ga0214178_10454351 | 3300020718 | Freshwater | MTVNQANLVNAKASTGEVTVSGKNVKFSARTAKADSFAV |
| Ga0214164_10216101 | 3300021138 | Freshwater | MTVNQANLVNAKANTGEVTVSGKGVKFSARTAKATLAV |
| Ga0194047_100609483 | 3300021354 | Anoxic Zone Freshwater | MTVNQAKSVNAKASTGEVTVSGKNIKFRTLAAKGQSLAV |
| Ga0194047_102189141 | 3300021354 | Anoxic Zone Freshwater | MTVNQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV |
| Ga0194047_102767192 | 3300021354 | Anoxic Zone Freshwater | MTVNQAKLVNAKANTGEVTVSGKNVKFSARTAQRQSLAV |
| Ga0194048_1000093810 | 3300021519 | Anoxic Zone Freshwater | MTVNQAKLVNANANTGEVTVSGKGVKFSARTVKATLAV |
| Ga0194048_103172031 | 3300021519 | Anoxic Zone Freshwater | MTVNQAKNVNADVNKTVTVTGKNVKFSARTAKEALAA |
| Ga0212088_101312272 | 3300022555 | Freshwater Lake Hypolimnion | MTVNQANLVNAKASTGEVTVSAKNLKFRTLAAKGQSLAV |
| Ga0212088_106736262 | 3300022555 | Freshwater Lake Hypolimnion | MTVNQANLVNAKANTGEVTVSGKGVKFSARTAKAESFAV |
| Ga0214919_1000121443 | 3300023184 | Freshwater | MTVNQANQVNAKASTGEVTVSGKNVKFSARTVKAESFAV |
| Ga0209616_10100972 | 3300025091 | Freshwater | MTVNQAKLVNAKASTGEVTVSGKNVKFSARTAKAESFAV |
| Ga0208383_10255333 | 3300025357 | Freshwater | MTVNQAKLVNANANTGEVTVSAKNLKFRTLAAKGQSLAV |
| Ga0208256_10493622 | 3300025382 | Freshwater | MTVNQAKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV |
| Ga0208875_10288143 | 3300025410 | Freshwater | MTVNQAKNLNANASKGEVTVSGKGIRFSARTAQRQTLAV |
| Ga0208614_10640461 | 3300025413 | Freshwater | MTVNQAKSVNANANTGEVTVSGKNVKFSARSAKATLAV |
| Ga0208742_10624732 | 3300025437 | Freshwater | MTVNQANYVNAKTSTGEVTVSGKNVKFSARTAQRQSLAV |
| Ga0208106_100014546 | 3300025449 | Freshwater | MTLNQAKLVNANANTKSGTVTVNGKGVKFSARTAKVALV |
| Ga0208497_10293604 | 3300025466 | Freshwater | MTVNQANLVNAKANTGEVTVSGKNIKFSARSAQRQSLAV |
| Ga0208497_10343582 | 3300025466 | Freshwater | NQAKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV |
| Ga0209195_10145551 | 3300025590 | Pelagic Marine | VNQAKLVNANANTKGSVTVSGKNIKFSRRGQEAVLA |
| Ga0208741_100161518 | 3300025723 | Freshwater | MIVNQANLVNAKASTGEVTVSGKNIKFHTLAAKGQSLAV |
| Ga0209188_10001148 | 3300027708 | Freshwater Lake | MTVNQANLVNAKASTGEVTVSAKNIKFRTLAAKGQSLAV |
| Ga0209188_101295510 | 3300027708 | Freshwater Lake | MTVNQANLVNATASTGEVTVKANKGIRFSARSTAKAEAFAV |
| Ga0209297_11902692 | 3300027733 | Freshwater Lake | MTVNQANLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV |
| Ga0209087_10489071 | 3300027734 | Freshwater Lake | MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV |
| Ga0209087_11139742 | 3300027734 | Freshwater Lake | MTANQAKLVNAKASTGEVTVSAKNLKFRTLAAKGQSLAV |
| Ga0209190_11076511 | 3300027736 | Freshwater Lake | MTVNQANQVNAKASTGEVTVSGKGVKFSARTVKAESFAV |
| Ga0209084_13287521 | 3300027749 | Freshwater Lake | MTVNQANLVNANANTGEVTVSGKNVKFRTLAAKGQTLAV |
| Ga0209596_10731322 | 3300027754 | Freshwater Lake | MILNQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV |
| Ga0209829_103132652 | 3300027777 | Freshwater Lake | MTVNQAKLVNANANTGEVTVSGKNVKFRTLAAKGQLLAV |
| Ga0209500_101662751 | 3300027782 | Freshwater Lake | AMTVNQAKLVNAKANTGEVTVSGKNVKFSTRSVKRQSFAV |
| Ga0209550_103546942 | 3300027892 | Freshwater Lake | MTVNQANLVNAKANTGEVTVSGKNIKFSARSVKRQSFAV |
| Ga0209777_102998213 | 3300027896 | Freshwater Lake Sediment | MTLNQAKLVNANANTGEVTVSGKNVKFRTLAAKGQTLAV |
| Ga0209668_1000171718 | 3300027899 | Freshwater Lake Sediment | MTVNQAKLVNAKASTGEVTVSGKGVKFSARTAKAESFAV |
| (restricted) Ga0247831_12641351 | 3300028559 | Freshwater | NQANIVNAKTSTGEVTVSGKNVKFSARTVKATLAV |
| Ga0315293_109319152 | 3300031746 | Sediment | MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSFAV |
| Ga0315909_102241432 | 3300031857 | Freshwater | GWGDSAEEAKNVNANVNKTVTVSGKNLKFSARSAKEALAV |
| Ga0316232_11420382 | 3300032605 | Freshwater | GFLVEEAKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV |
| ⦗Top⦘ |