


| Basic Information | |
|---|---|
| Family ID | F089532 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 42.20 % |
| % of genes near scaffold ends (potentially truncated) | 34.86 % |
| % of genes from short scaffolds (< 2000 bps) | 80.73 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (33.028 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (22.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.972 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.156 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 76.74% β-sheet: 0.00% Coil/Unstructured: 23.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF12684 | DUF3799 | 23.85 |
| PF13392 | HNH_3 | 19.27 |
| PF08299 | Bac_DnaA_C | 14.68 |
| PF01555 | N6_N4_Mtase | 8.26 |
| PF02195 | ParBc | 8.26 |
| PF10544 | T5orf172 | 3.67 |
| PF04466 | Terminase_3 | 3.67 |
| PF14550 | Peptidase_S78_2 | 1.83 |
| PF00856 | SET | 1.83 |
| PF08291 | Peptidase_M15_3 | 0.92 |
| PF03796 | DnaB_C | 0.92 |
| PF05766 | NinG | 0.92 |
| PF13455 | MUG113 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 14.68 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 8.26 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 8.26 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 8.26 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 3.67 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.92 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.97 % |
| Unclassified | root | N/A | 33.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10196691 | Not Available | 649 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10242403 | Not Available | 553 | Open in IMG/M |
| 3300001450|JGI24006J15134_10001459 | Not Available | 13468 | Open in IMG/M |
| 3300001947|GOS2218_1008191 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1428 | Open in IMG/M |
| 3300002483|JGI25132J35274_1063651 | Not Available | 781 | Open in IMG/M |
| 3300002483|JGI25132J35274_1068345 | Not Available | 747 | Open in IMG/M |
| 3300003409|JGI26088J50261_1000332 | Not Available | 28307 | Open in IMG/M |
| 3300003409|JGI26088J50261_1001755 | Not Available | 11447 | Open in IMG/M |
| 3300004457|Ga0066224_1175202 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
| 3300005239|Ga0073579_1189330 | Not Available | 29227 | Open in IMG/M |
| 3300005433|Ga0066830_10001135 | All Organisms → Viruses → Predicted Viral | 4565 | Open in IMG/M |
| 3300005510|Ga0066825_10052971 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
| 3300005512|Ga0074648_1004443 | Not Available | 11181 | Open in IMG/M |
| 3300005613|Ga0074649_1008290 | Not Available | 7870 | Open in IMG/M |
| 3300005747|Ga0076924_1100914 | All Organisms → Viruses → Predicted Viral | 1371 | Open in IMG/M |
| 3300005837|Ga0078893_10621391 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
| 3300006026|Ga0075478_10254794 | Not Available | 525 | Open in IMG/M |
| 3300006752|Ga0098048_1092878 | Not Available | 916 | Open in IMG/M |
| 3300006752|Ga0098048_1131228 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 750 | Open in IMG/M |
| 3300006793|Ga0098055_1111718 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300007276|Ga0070747_1203851 | Not Available | 696 | Open in IMG/M |
| 3300007276|Ga0070747_1268429 | All Organisms → Viruses | 590 | Open in IMG/M |
| 3300007538|Ga0099851_1172365 | Not Available | 798 | Open in IMG/M |
| 3300007539|Ga0099849_1015920 | All Organisms → Viruses → Predicted Viral | 3301 | Open in IMG/M |
| 3300007539|Ga0099849_1048846 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
| 3300007539|Ga0099849_1076669 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300007539|Ga0099849_1083809 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300007539|Ga0099849_1096399 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300007539|Ga0099849_1307983 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 570 | Open in IMG/M |
| 3300007539|Ga0099849_1313257 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas → unclassified Dysgonomonas → Dysgonomonas sp. Marseille-P4677 | 564 | Open in IMG/M |
| 3300007539|Ga0099849_1350200 | Not Available | 525 | Open in IMG/M |
| 3300007542|Ga0099846_1076928 | All Organisms → Viruses → Predicted Viral | 1243 | Open in IMG/M |
| 3300007542|Ga0099846_1266752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Nonlabens virus P12024L | 592 | Open in IMG/M |
| 3300007640|Ga0070751_1010368 | All Organisms → Viruses → Predicted Viral | 4764 | Open in IMG/M |
| 3300007640|Ga0070751_1160391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Nonlabens virus P12024L | 894 | Open in IMG/M |
| 3300008012|Ga0075480_10435291 | Not Available | 641 | Open in IMG/M |
| 3300010149|Ga0098049_1066566 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300010296|Ga0129348_1084668 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
| 3300010296|Ga0129348_1131238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas → unclassified Dysgonomonas → Dysgonomonas sp. Marseille-P4677 | 873 | Open in IMG/M |
| 3300010297|Ga0129345_1050088 | All Organisms → Viruses → Predicted Viral | 1600 | Open in IMG/M |
| 3300010297|Ga0129345_1137427 | Not Available | 887 | Open in IMG/M |
| 3300010297|Ga0129345_1214438 | All Organisms → Viruses | 680 | Open in IMG/M |
| 3300010297|Ga0129345_1291887 | Not Available | 565 | Open in IMG/M |
| 3300010299|Ga0129342_1153023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Anaerotruncus | 840 | Open in IMG/M |
| 3300010299|Ga0129342_1183118 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 750 | Open in IMG/M |
| 3300010299|Ga0129342_1254731 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas → unclassified Dysgonomonas → Dysgonomonas sp. Marseille-P4677 | 611 | Open in IMG/M |
| 3300010300|Ga0129351_1099435 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300010300|Ga0129351_1132665 | Not Available | 989 | Open in IMG/M |
| 3300010300|Ga0129351_1355416 | Not Available | 549 | Open in IMG/M |
| 3300010318|Ga0136656_1141346 | All Organisms → Viruses | 827 | Open in IMG/M |
| 3300011118|Ga0114922_11720907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium | 502 | Open in IMG/M |
| 3300011253|Ga0151671_1007751 | Not Available | 8380 | Open in IMG/M |
| 3300011254|Ga0151675_1023364 | All Organisms → Viruses → Predicted Viral | 1474 | Open in IMG/M |
| 3300012967|Ga0129343_1122356 | Not Available | 550 | Open in IMG/M |
| 3300017714|Ga0181412_1002352 | Not Available | 6874 | Open in IMG/M |
| 3300017719|Ga0181390_1001910 | Not Available | 8921 | Open in IMG/M |
| 3300017735|Ga0181431_1033197 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300017735|Ga0181431_1040864 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1056 | Open in IMG/M |
| 3300017749|Ga0181392_1141866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300017770|Ga0187217_1225784 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 616 | Open in IMG/M |
| 3300017781|Ga0181423_1131389 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 971 | Open in IMG/M |
| 3300017782|Ga0181380_1063338 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300017783|Ga0181379_1330164 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 515 | Open in IMG/M |
| 3300018080|Ga0180433_10655391 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 784 | Open in IMG/M |
| 3300018420|Ga0181563_10394026 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 792 | Open in IMG/M |
| 3300018420|Ga0181563_10402751 | Not Available | 781 | Open in IMG/M |
| 3300018424|Ga0181591_10724930 | Not Available | 697 | Open in IMG/M |
| 3300019459|Ga0181562_10427617 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 636 | Open in IMG/M |
| 3300021335|Ga0213867_1085394 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300021373|Ga0213865_10010955 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5226 | Open in IMG/M |
| 3300021373|Ga0213865_10038269 | All Organisms → Viruses → Predicted Viral | 2680 | Open in IMG/M |
| 3300021375|Ga0213869_10310732 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 669 | Open in IMG/M |
| 3300021958|Ga0222718_10101559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1694 | Open in IMG/M |
| 3300021958|Ga0222718_10129116 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
| 3300021960|Ga0222715_10011526 | Not Available | 7012 | Open in IMG/M |
| 3300021960|Ga0222715_10228116 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300021961|Ga0222714_10358258 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 782 | Open in IMG/M |
| 3300022187|Ga0196899_1104107 | Not Available | 837 | Open in IMG/M |
| 3300022201|Ga0224503_10166807 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 709 | Open in IMG/M |
| 3300022202|Ga0224498_10204316 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 586 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10513854 | All Organisms → Viruses | 542 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10010806 | All Organisms → Viruses → Predicted Viral | 3011 | Open in IMG/M |
| 3300024183|Ga0228603_1000022 | Not Available | 29104 | Open in IMG/M |
| 3300024188|Ga0228602_1087718 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 540 | Open in IMG/M |
| 3300024229|Ga0233402_1017703 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| 3300024229|Ga0233402_1116547 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 552 | Open in IMG/M |
| 3300024266|Ga0228661_1013857 | All Organisms → Viruses → Predicted Viral | 1416 | Open in IMG/M |
| 3300024266|Ga0228661_1029420 | Not Available | 996 | Open in IMG/M |
| 3300024316|Ga0228654_1030052 | Not Available | 795 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10130546 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1097 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10131157 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10278675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium | 847 | Open in IMG/M |
| 3300025083|Ga0208791_1026360 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
| 3300025108|Ga0208793_1002552 | Not Available | 9422 | Open in IMG/M |
| 3300025141|Ga0209756_1035044 | All Organisms → Viruses → Predicted Viral | 2633 | Open in IMG/M |
| 3300025151|Ga0209645_1153051 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 710 | Open in IMG/M |
| 3300025608|Ga0209654_1002886 | Not Available | 11160 | Open in IMG/M |
| 3300025674|Ga0208162_1038359 | All Organisms → Viruses → Predicted Viral | 1690 | Open in IMG/M |
| 3300025674|Ga0208162_1056668 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300025674|Ga0208162_1064858 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300025674|Ga0208162_1119685 | All Organisms → Viruses | 757 | Open in IMG/M |
| 3300026136|Ga0208763_1001207 | All Organisms → Viruses → Predicted Viral | 4721 | Open in IMG/M |
| 3300026136|Ga0208763_1039497 | Not Available | 701 | Open in IMG/M |
| 3300028115|Ga0233450_10369849 | Not Available | 579 | Open in IMG/M |
| 3300031578|Ga0307376_10538257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Nonlabens virus P12024L | 751 | Open in IMG/M |
| 3300032277|Ga0316202_10193927 | Not Available | 943 | Open in IMG/M |
| 3300032373|Ga0316204_10340830 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300034374|Ga0348335_094735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Nonlabens virus P12024L | 960 | Open in IMG/M |
| 3300034375|Ga0348336_047009 | All Organisms → Viruses → Predicted Viral | 1819 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.94% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.76% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 11.93% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.01% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 10.09% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.59% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.59% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.67% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.83% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.83% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.83% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.83% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.83% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.92% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.92% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.92% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.92% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.92% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300003409 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024183 | Seawater microbial communities from Monterey Bay, California, United States - 3D | Environmental | Open in IMG/M |
| 3300024188 | Seawater microbial communities from Monterey Bay, California, United States - 2D | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024266 | Seawater microbial communities from Monterey Bay, California, United States - 75D | Environmental | Open in IMG/M |
| 3300024316 | Seawater microbial communities from Monterey Bay, California, United States - 66D | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101966913 | 3300000116 | Marine | ETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE* |
| DelMOSpr2010_102424032 | 3300000116 | Marine | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYD* |
| JGI24006J15134_1000145910 | 3300001450 | Marine | METIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDT* |
| GOS2218_10081912 | 3300001947 | Marine | TIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE* |
| JGI25132J35274_10636512 | 3300002483 | Marine | MKGFISDIEMIQLVIKLGGYEDALEMLQEVKEEMIILDALNYEYVRPH* |
| JGI25132J35274_10683452 | 3300002483 | Marine | VKKYGNGTESNRKKQVMKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDT |
| JGI26088J50261_100033227 | 3300003409 | Marine | MQDFINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYE* |
| JGI26088J50261_100175512 | 3300003409 | Marine | MKDFINDMEMIQLAINLGDYHDAMRMLQEVKEEMIILDALNYD* |
| Ga0066224_11752022 | 3300004457 | Marine | MKGFISDMETIQLAIKLGDYEEALEMLQEVKEEMIILDLLNYD* |
| Ga0073579_118933044 | 3300005239 | Marine | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE* |
| Ga0066830_100011351 | 3300005433 | Marine | MKGFISDIEMIQLVIKLGGYEDALEMLQEVKEEMIILDALNYDA* |
| Ga0066825_100529713 | 3300005510 | Marine | MKGFISDIEMIQLVIKLGGYEAALEMLQVVKEEMIILDALNYE* |
| Ga0074648_100444316 | 3300005512 | Saline Water And Sediment | MQEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYD* |
| Ga0074649_100829020 | 3300005613 | Saline Water And Sediment | MTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYD* |
| Ga0076924_11009142 | 3300005747 | Marine | MIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0078893_106213913 | 3300005837 | Marine Surface Water | LKRFISDIETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE* |
| Ga0075478_102547942 | 3300006026 | Aqueous | MQEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYDA* |
| Ga0098048_10928782 | 3300006752 | Marine | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMII |
| Ga0098048_11312282 | 3300006752 | Marine | METIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE* |
| Ga0098055_11117181 | 3300006793 | Marine | SDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE* |
| Ga0070747_12038511 | 3300007276 | Aqueous | HTISMKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYD* |
| Ga0070747_12684291 | 3300007276 | Aqueous | RQLHIKRYAMKRFISDMETIQLAIKLGDYEEALEMLQEVKEEMIILDALNYE* |
| Ga0099851_11723651 | 3300007538 | Aqueous | MIQLAIKLGDYYDALQMLQEVKEEMIILDALNYDA* |
| Ga0099849_10159202 | 3300007539 | Aqueous | LKDFINDMEMIQLAIKLGDYHDAMRMLQEVKEEMIILDALNYE* |
| Ga0099849_10488461 | 3300007539 | Aqueous | MQDFINDIEMIQLAIKLGDYYDALQMLQEVKEELILYDALN* |
| Ga0099849_10766692 | 3300007539 | Aqueous | LKDFINDMEMIMLAIKLGDYHDAMRMLQEVKEEMIILDALNYE* |
| Ga0099849_10838092 | 3300007539 | Aqueous | MQDFINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYD* |
| Ga0099849_10963992 | 3300007539 | Aqueous | MTDLINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0099849_13079831 | 3300007539 | Aqueous | NDIEMIQLAIKLGDYYDALQMLQEVKEELILYDALNYE* |
| Ga0099849_13132571 | 3300007539 | Aqueous | EIILKDFINDMEMIMLAIKLGDYHDAMRMLQEVKEEMIILDALNYE* |
| Ga0099849_13502001 | 3300007539 | Aqueous | RYAMTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0099846_10769282 | 3300007542 | Aqueous | MTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0099846_12667522 | 3300007542 | Aqueous | MQEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNY |
| Ga0070751_10103688 | 3300007640 | Aqueous | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDA* |
| Ga0070751_11603912 | 3300007640 | Aqueous | MQEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0075480_104352912 | 3300008012 | Aqueous | MQEFINDIEMIQLAIKLGDYYDALQMLQEVKEEIIILDALNYDA* |
| Ga0098049_10665663 | 3300010149 | Marine | LKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE* |
| Ga0129348_10846682 | 3300010296 | Freshwater To Marine Saline Gradient | MTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYE* |
| Ga0129348_11312381 | 3300010296 | Freshwater To Marine Saline Gradient | LINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0129345_10500883 | 3300010297 | Freshwater To Marine Saline Gradient | MQDFINDIEMIQLAIKLGDYYDALQMLQEVKEELILYDALNYE* |
| Ga0129345_11374272 | 3300010297 | Freshwater To Marine Saline Gradient | MQDLINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYD* |
| Ga0129345_12144381 | 3300010297 | Freshwater To Marine Saline Gradient | MIQLAIKLGDYYDALQMLQEVKEEMLILDALNYE* |
| Ga0129345_12918873 | 3300010297 | Freshwater To Marine Saline Gradient | LHIKRYAMTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0129342_11530232 | 3300010299 | Freshwater To Marine Saline Gradient | LTDFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYDA* |
| Ga0129342_11831181 | 3300010299 | Freshwater To Marine Saline Gradient | AMTEFINDIEMIQLAIKLGDYYDALQMLQEVKEELILYDALNYE* |
| Ga0129342_12547311 | 3300010299 | Freshwater To Marine Saline Gradient | TDLINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0129351_10994351 | 3300010300 | Freshwater To Marine Saline Gradient | NDIEMIQLAIKLGDYYDALQMLQEVKEELILYDALN* |
| Ga0129351_11326651 | 3300010300 | Freshwater To Marine Saline Gradient | MQDLINDIEMIQLAIKLGDYYDALQMLQEVKEELILYDALN |
| Ga0129351_13554161 | 3300010300 | Freshwater To Marine Saline Gradient | DLINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE* |
| Ga0136656_11413461 | 3300010318 | Freshwater To Marine Saline Gradient | IEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYE* |
| Ga0114922_117209071 | 3300011118 | Deep Subsurface | KRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE* |
| Ga0151671_100775113 | 3300011253 | Marine | MKGFISDIEIVMMAIKLGDYEDALEILQAVKEEMIILDLLNYD* |
| Ga0151675_10233642 | 3300011254 | Marine | MKGFISDIEIVMMAIKLGDYEDALEILQAVKEEMIILDLLNYE* |
| Ga0129343_11223562 | 3300012967 | Aqueous | MTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYDA* |
| Ga0181412_100235218 | 3300017714 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDA |
| Ga0181390_100191019 | 3300017719 | Seawater | MKRFISDIEMIQLAIKLGDYEDALEMLQEVKEEMIIKEDKRLMIILDALNYE |
| Ga0181431_10331972 | 3300017735 | Seawater | MKRFISDMETIQLAIKLGDYEDALQMLQEVKEEMIILDALNYDA |
| Ga0181431_10408642 | 3300017735 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEIIILDALNYE |
| Ga0181392_11418662 | 3300017749 | Seawater | METIQLAIKLGDYEDALQMLQEVKEEMIILDALNYDA |
| Ga0187217_12257841 | 3300017770 | Seawater | ISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE |
| Ga0181423_11313891 | 3300017781 | Seawater | MIDLINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE |
| Ga0181380_10633383 | 3300017782 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDVLNYE |
| Ga0181379_13301641 | 3300017783 | Seawater | AIKLGDYEDALEMLQEVKEEMIIKEDKRLMIILDALNYE |
| Ga0180433_106553912 | 3300018080 | Hypersaline Lake Sediment | MTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYE |
| Ga0181563_103940264 | 3300018420 | Salt Marsh | ILNRFINDLELVMLAIRNEDLEDALLMLQEIREEMIILDALNYE |
| Ga0181563_104027511 | 3300018420 | Salt Marsh | FINDLELVMLAIRNEDLEDALLMLQEIREEMIILDALNYE |
| Ga0181591_107249302 | 3300018424 | Salt Marsh | MTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYDA |
| Ga0181562_104276173 | 3300019459 | Salt Marsh | MTRFINDLELVMLAIRNEDLEDALLMLQEIREEMIILDALNYE |
| Ga0213867_10853942 | 3300021335 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYD |
| Ga0213865_1001095513 | 3300021373 | Seawater | MQDFINDIEMIQLAIKLGDYYDALQMLQEVKEELILYDALN |
| Ga0213865_100382693 | 3300021373 | Seawater | METIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE |
| Ga0213869_103107322 | 3300021375 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE |
| Ga0222718_101015592 | 3300021958 | Estuarine Water | MTDFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE |
| Ga0222718_101291163 | 3300021958 | Estuarine Water | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIIKEDKRLMIILDALNYDA |
| Ga0222715_100115263 | 3300021960 | Estuarine Water | MKGFISDIEMIQLVIKLGGYEDALEMLQEVKEEMIILDALNYE |
| Ga0222715_102281162 | 3300021960 | Estuarine Water | MTEFINDIETIMLAIKLGDYQDALTMLQEVKEEMIILDALNYD |
| Ga0222714_103582582 | 3300021961 | Estuarine Water | MTEFINDIETIMLAIKLGDYQDALIMLQEVKEEMIILDALNYD |
| Ga0196899_11041074 | 3300022187 | Aqueous | TIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDA |
| Ga0224503_101668072 | 3300022201 | Sediment | MKRFISDMETIQLAIKLGDYYDALQMLQEVKEEMIIKEDKRLMIILDALNYE |
| Ga0224498_102043162 | 3300022202 | Sediment | MKGFISDMETIQLAIKLGDYEEALEMLQEVKEEMIILDALNYE |
| (restricted) Ga0233412_105138542 | 3300023210 | Seawater | MKRFISDMETIQLAIKLGDYEDALQMLQEVKEEMIILDALNYE |
| (restricted) Ga0255040_100108064 | 3300024059 | Seawater | MKGFISDMETIQLAIKLGDYEEALEMLQEVKEEMIILDLFNYE |
| Ga0228603_100002216 | 3300024183 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDK |
| Ga0228602_10877181 | 3300024188 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALN |
| Ga0233402_10177031 | 3300024229 | Seawater | KRHTMKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE |
| Ga0233402_11165471 | 3300024229 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIIL |
| Ga0228661_10138575 | 3300024266 | Seawater | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDAL |
| Ga0228661_10294201 | 3300024266 | Seawater | ISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDK |
| Ga0228654_10300521 | 3300024316 | Seawater | KRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDK |
| (restricted) Ga0255046_101305463 | 3300024519 | Seawater | MKGFISDIEIVMMAIKLGDYEDALEILQAVKEEMIILDLLNYD |
| (restricted) Ga0255046_101311572 | 3300024519 | Seawater | MKGFISDMEIVMMAIKLGDYEDALEILQAVKEEMIILDLLNYD |
| (restricted) Ga0255047_102786752 | 3300024520 | Seawater | MQDFINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYE |
| Ga0208791_10263601 | 3300025083 | Marine | IILMKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE |
| Ga0208793_10025521 | 3300025108 | Marine | SDMETIQLAIKLGDYEDALEMLQEVKEEMIILDALNYE |
| Ga0209756_10350442 | 3300025141 | Marine | MKGFISDIEMIQLVIKLGGYEAALEMLQVVKEEMIILDALNYE |
| Ga0209645_11530513 | 3300025151 | Marine | METIQLAIKLGDYEDALEMLQEVKEEMIILDALNYDT |
| Ga0209654_100288623 | 3300025608 | Marine | MKDFINDMEMIQLAINLGDYHDAMRMLQEVKEEMIILDALNYD |
| Ga0208162_10383594 | 3300025674 | Aqueous | TNKTILMQDFINDIEMIQLAIKLGDYYDALQMLQEVKEELILYDALN |
| Ga0208162_10566683 | 3300025674 | Aqueous | MQDFINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYD |
| Ga0208162_10648582 | 3300025674 | Aqueous | MTEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE |
| Ga0208162_11196851 | 3300025674 | Aqueous | QLHIKRYAMTDLINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYE |
| Ga0208763_100120714 | 3300026136 | Marine | MKGFISDIEMIQLVIKLGGYEDALEMLQEVKEEMIILDALNYDT |
| Ga0208763_10394973 | 3300026136 | Marine | EMIQLVIKLGGYEAALEMLQVVKEEMIILDALNYE |
| Ga0233450_103698492 | 3300028115 | Salt Marsh | LNRFINDLELVMLAIRNEDLEDALLMLQEIREEMIILDALNYE |
| Ga0307376_105382572 | 3300031578 | Soil | MQDLINDIEMIQLAIKLGDYYDALQMLQEVKEEMLILDALNYE |
| Ga0316202_101939271 | 3300032277 | Microbial Mat | MKRFISDMETIQLAIKLGDYEEALEMLQEVKEEMIILDALNYE |
| Ga0316204_103408302 | 3300032373 | Microbial Mat | METIQLAIKLGDYEDALEMLQEVKEEMIILDALNYD |
| Ga0348335_094735_463_597 | 3300034374 | Aqueous | MQEFINDIEMIQLAIKLGDYYDALQMLQEVKEEMIILDALNYDA |
| Ga0348336_047009_3_107 | 3300034375 | Aqueous | MKRFISDMETIQLAIKLGDYEDALEMLQEVKEEMI |
| ⦗Top⦘ |