


| Basic Information | |
|---|---|
| Family ID | F089461 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 44 residues |
| Representative Sequence | SWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGGWW |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.25 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.413 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.275 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.872 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.94% Coil/Unstructured: 76.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF12544 | LAM_C | 51.38 |
| PF04055 | Radical_SAM | 17.43 |
| PF02776 | TPP_enzyme_N | 4.59 |
| PF02146 | SIR2 | 0.92 |
| PF01551 | Peptidase_M23 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.41 % |
| Unclassified | root | N/A | 4.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003911|JGI25405J52794_10094961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300004480|Ga0062592_100908260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
| 3300005147|Ga0066821_1010468 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005165|Ga0066869_10104290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300005332|Ga0066388_103447717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300005332|Ga0066388_107732780 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005356|Ga0070674_102103890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 515 | Open in IMG/M |
| 3300005363|Ga0008090_10175721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300005363|Ga0008090_10208770 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005440|Ga0070705_100254817 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300005713|Ga0066905_102274627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300005764|Ga0066903_107117675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300005764|Ga0066903_107496942 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005764|Ga0066903_109120511 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005842|Ga0068858_101635076 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006048|Ga0075363_100997699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300006163|Ga0070715_10366124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300006175|Ga0070712_100490606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300006604|Ga0074060_12002991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300006845|Ga0075421_101460237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300006914|Ga0075436_100407613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
| 3300009090|Ga0099827_10203770 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300010046|Ga0126384_10872091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 811 | Open in IMG/M |
| 3300010046|Ga0126384_11373883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 658 | Open in IMG/M |
| 3300010047|Ga0126382_11482292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium violaceum | 623 | Open in IMG/M |
| 3300010360|Ga0126372_10370940 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300010362|Ga0126377_11190837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300010362|Ga0126377_11496066 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010366|Ga0126379_10416471 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300010376|Ga0126381_100580801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1592 | Open in IMG/M |
| 3300010376|Ga0126381_103561800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 611 | Open in IMG/M |
| 3300010376|Ga0126381_104426155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 543 | Open in IMG/M |
| 3300010376|Ga0126381_104677505 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010398|Ga0126383_13153741 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010401|Ga0134121_10256561 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300012211|Ga0137377_10328393 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300012354|Ga0137366_10077038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2537 | Open in IMG/M |
| 3300012354|Ga0137366_10320378 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300012917|Ga0137395_11236626 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012960|Ga0164301_11238325 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300012971|Ga0126369_10589228 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300015077|Ga0173483_10155323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1014 | Open in IMG/M |
| 3300015359|Ga0134085_10593247 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300015371|Ga0132258_11812173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1538 | Open in IMG/M |
| 3300016270|Ga0182036_11592091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 550 | Open in IMG/M |
| 3300016270|Ga0182036_11746796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 526 | Open in IMG/M |
| 3300016319|Ga0182033_11921090 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300016445|Ga0182038_12191353 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300018061|Ga0184619_10521829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300018074|Ga0184640_10371479 | Not Available | 647 | Open in IMG/M |
| 3300018083|Ga0184628_10048425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2142 | Open in IMG/M |
| 3300018481|Ga0190271_11241354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 867 | Open in IMG/M |
| 3300021078|Ga0210381_10304105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300021080|Ga0210382_10138743 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300021168|Ga0210406_11255130 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300021560|Ga0126371_12177617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300022756|Ga0222622_10253372 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300025923|Ga0207681_10136351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1822 | Open in IMG/M |
| 3300025937|Ga0207669_10976760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300025960|Ga0207651_11322493 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026088|Ga0207641_10005658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 10639 | Open in IMG/M |
| 3300026121|Ga0207683_10115259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2409 | Open in IMG/M |
| 3300026550|Ga0209474_10412895 | Not Available | 698 | Open in IMG/M |
| 3300026557|Ga0179587_10990286 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300027654|Ga0209799_1026262 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300027748|Ga0209689_1005258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 9263 | Open in IMG/M |
| 3300027880|Ga0209481_10470865 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300028705|Ga0307276_10078752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300028707|Ga0307291_1066525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300028720|Ga0307317_10027630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1759 | Open in IMG/M |
| 3300028722|Ga0307319_10054465 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300028824|Ga0307310_10503048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
| 3300031231|Ga0170824_115819062 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031474|Ga0170818_100890561 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031544|Ga0318534_10425826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300031544|Ga0318534_10716960 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031549|Ga0318571_10356127 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031561|Ga0318528_10032915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2558 | Open in IMG/M |
| 3300031640|Ga0318555_10496544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 661 | Open in IMG/M |
| 3300031682|Ga0318560_10512160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300031719|Ga0306917_10135163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1813 | Open in IMG/M |
| 3300031720|Ga0307469_11772730 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031724|Ga0318500_10045461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1840 | Open in IMG/M |
| 3300031744|Ga0306918_11051195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300031765|Ga0318554_10517842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300031769|Ga0318526_10043676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1688 | Open in IMG/M |
| 3300031781|Ga0318547_10002871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6808 | Open in IMG/M |
| 3300031792|Ga0318529_10151020 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300031793|Ga0318548_10436337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300031821|Ga0318567_10899195 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031879|Ga0306919_10481180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 956 | Open in IMG/M |
| 3300031879|Ga0306919_10972417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300031890|Ga0306925_10771093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1000 | Open in IMG/M |
| 3300031894|Ga0318522_10404331 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031897|Ga0318520_11092399 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031946|Ga0310910_10819175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300031947|Ga0310909_11516198 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032051|Ga0318532_10303741 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300032052|Ga0318506_10277629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300032055|Ga0318575_10140962 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300032063|Ga0318504_10062422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1597 | Open in IMG/M |
| 3300032089|Ga0318525_10125543 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300032090|Ga0318518_10257425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 895 | Open in IMG/M |
| 3300033290|Ga0318519_10080264 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300033433|Ga0326726_12326519 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300033551|Ga0247830_11108756 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25405J52794_100949612 | 3300003911 | Tabebuia Heterophylla Rhizosphere | TPACFSWAAGERIRLIAGDWNGRCIGAIFYNYARRTRCETWCGW* |
| Ga0062592_1009082601 | 3300004480 | Soil | WAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMSCGGSRW* |
| Ga0066821_10104682 | 3300005147 | Soil | FVGRTPACWSWAAGEPIRLLAGDWNGRCDYAVFYNFYRRSTCEMSCGGSRW* |
| Ga0066869_101042902 | 3300005165 | Soil | TPACFSWAAGERIRLISGDWNGRCVAALFYNFYRRNTCEVWCGGGGWW* |
| Ga0066388_1034477172 | 3300005332 | Tropical Forest Soil | GWAPGERIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGGGWW* |
| Ga0066388_1077327802 | 3300005332 | Tropical Forest Soil | FSWAAGERIRLIAGDWNGRCVAARFYNFYRRDTCDVWCGSGGWW* |
| Ga0070674_1021038902 | 3300005356 | Miscanthus Rhizosphere | RTPACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW* |
| Ga0008090_101757212 | 3300005363 | Tropical Rainforest Soil | AGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW* |
| Ga0008090_102087701 | 3300005363 | Tropical Rainforest Soil | AGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW* |
| Ga0070705_1002548172 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | CWSWAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMSCGGSRW* |
| Ga0066905_1022746271 | 3300005713 | Tropical Forest Soil | ACFSWAAGERIRLIAGDWNGRCIGAIFYNYARRNRCETWCGW* |
| Ga0066903_1071176752 | 3300005764 | Tropical Forest Soil | AGERIRLLAGDWNGRCVAARFYNFYRRNTCDMWCGGGGW* |
| Ga0066903_1074969422 | 3300005764 | Tropical Forest Soil | SGKTPACLSWAAGEQITLVAGDWHGRCVDAVFYNYPRRSTCEVSCGWGRY* |
| Ga0066903_1091205112 | 3300005764 | Tropical Forest Soil | SCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW* |
| Ga0068858_1016350761 | 3300005842 | Switchgrass Rhizosphere | CWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW* |
| Ga0075363_1009976991 | 3300006048 | Populus Endosphere | TPACWSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCQMLCGGSRW* |
| Ga0070715_103661242 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | FGWVAGERITLVAGDWNARCVVAVFYNFYRRNTCEMWCGGSGWW* |
| Ga0070712_1004906061 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | CFGWVAGERITLVAGDWNARCVVAVFYNFYRRNTCEVWCGGGWW* |
| Ga0074060_120029912 | 3300006604 | Soil | WAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEVWCGGGGWW* |
| Ga0075421_1014602372 | 3300006845 | Populus Rhizosphere | CLHWAAGERIRLIAGDWNGRCVGAIFYNYARRNRCEMWCGW* |
| Ga0075436_1004076131 | 3300006914 | Populus Rhizosphere | IRLIAGDWNGRCVAARFYNFYRRNTCEVSCGGGGWW* |
| Ga0099827_102037701 | 3300009090 | Vadose Zone Soil | RRFTAKTPACMRWAAGERIRLIAGDWNGRCVDAVFYNYFWRGTCEMWCGW* |
| Ga0126384_108720913 | 3300010046 | Tropical Forest Soil | GERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGGWW* |
| Ga0126384_113738831 | 3300010046 | Tropical Forest Soil | RIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGGWWW* |
| Ga0126382_114822922 | 3300010047 | Tropical Forest Soil | FTGWAPACFRWVAGERIRLIAGDWNGRCIGAIFYNYARRNRCEMWCGW* |
| Ga0126372_103709402 | 3300010360 | Tropical Forest Soil | RIRLIAGDWNGRCVAARFYNFYRRNTCDVSCGSGGWWW* |
| Ga0126377_111503162 | 3300010362 | Tropical Forest Soil | RITLIAGDWHGRCDAAVFYNYARHNTCEVSCGGGWW* |
| Ga0126377_111908371 | 3300010362 | Tropical Forest Soil | MRWAAGEPIRLIAGDWNGRCVDAIFYNYFWRSTCEMSCGRSWWY* |
| Ga0126377_114960662 | 3300010362 | Tropical Forest Soil | ARTPACLGWAPGERIRLIAGDWNGRCVTAVFYNFYRRSTCEMWCGGGWW* |
| Ga0126379_104164713 | 3300010366 | Tropical Forest Soil | IRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGGWWW* |
| Ga0126381_1005808013 | 3300010376 | Tropical Forest Soil | TPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW* |
| Ga0126381_1035618002 | 3300010376 | Tropical Forest Soil | GWAAGERIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGGWWW* |
| Ga0126381_1044261551 | 3300010376 | Tropical Forest Soil | TPACFSWAAGERIRLIAGDWNGRCVAAVFYNFYRRSTCEMWCGGSWWW* |
| Ga0126381_1046775052 | 3300010376 | Tropical Forest Soil | FSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW* |
| Ga0126383_131537412 | 3300010398 | Tropical Forest Soil | FSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGGWW* |
| Ga0134121_102565612 | 3300010401 | Terrestrial Soil | TPACWSWAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMSCGGSRW* |
| Ga0137377_103283931 | 3300012211 | Vadose Zone Soil | CFAWAAGERIRLLAGDWNGRCVVALFYNFYRRNTCEMWCGGGWW* |
| Ga0137366_100770383 | 3300012354 | Vadose Zone Soil | GERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGCWW* |
| Ga0137366_103203782 | 3300012354 | Vadose Zone Soil | CFGWAAGERIRLLAGDWNARCAVAVFYNFYRRNTCEMWCGSGWWW* |
| Ga0137395_112366261 | 3300012917 | Vadose Zone Soil | ERIRLLAGDWNGRCVVALFYNFYRRNTCEMWCGGGWW* |
| Ga0164301_112383251 | 3300012960 | Soil | RITLVAGDWNARCAVAVFYNFYRRNTCEMWCGGGGWW* |
| Ga0126369_105892281 | 3300012971 | Tropical Forest Soil | ARTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW* |
| Ga0075304_10352682 | 3300014307 | Natural And Restored Wetlands | GEQIKLIEGDWNGRCVEAVFYNVWRRSTCVTVCEGNGWRWW* |
| Ga0173483_101553231 | 3300015077 | Soil | ERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW* |
| Ga0134085_105932471 | 3300015359 | Grasslands Soil | RSPSCFGWAAGERIRLLAGDWNARCAVAVFYNFYRRNTCEMLCGSGWWW* |
| Ga0132258_118121733 | 3300015371 | Arabidopsis Rhizosphere | WSWAAGERIKLLAGDWNARCDYAAFYNFYRRSTCEMWCGGSRW* |
| Ga0182036_115920912 | 3300016270 | Soil | TPACFSWAAGERIRLIAGDWNGRCVAALFYNFYRRNTCEVWCGGGGWW |
| Ga0182036_117467961 | 3300016270 | Soil | ARTPACFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0182033_119210902 | 3300016319 | Soil | SWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0182038_121913531 | 3300016445 | Soil | ACFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDMWCGGGGWW |
| Ga0184619_105218291 | 3300018061 | Groundwater Sediment | TGKSRACFNWAAGERIKLIAGDWNARCTEAVFYNFYRRSTCEMWCRPW |
| Ga0184640_103714791 | 3300018074 | Groundwater Sediment | FVGRSPACWSWAAGERIKLLAGNWNARCDYAVFYNFYRRSTCEMWCGGSRW |
| Ga0184628_100484251 | 3300018083 | Groundwater Sediment | SWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMLCGGSRW |
| Ga0190271_112413541 | 3300018481 | Soil | ACWSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMLCGGSRW |
| Ga0210381_103041051 | 3300021078 | Groundwater Sediment | ACWSWAAGEAIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW |
| Ga0210382_101387432 | 3300021080 | Groundwater Sediment | RIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW |
| Ga0210406_112551301 | 3300021168 | Soil | ERITLVAGDWNARCVVAVFYNFYRRNTCEMWCGGGGWW |
| Ga0126371_121776172 | 3300021560 | Tropical Forest Soil | SWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEMWCGGGGWW |
| Ga0222622_102533721 | 3300022756 | Groundwater Sediment | GERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW |
| Ga0207681_101363513 | 3300025923 | Switchgrass Rhizosphere | RTPACWSWAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMLCGGSRW |
| Ga0207669_109767601 | 3300025937 | Miscanthus Rhizosphere | TPACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW |
| Ga0207651_113224932 | 3300025960 | Switchgrass Rhizosphere | ACWSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCQMLCGGSRW |
| Ga0207641_100056581 | 3300026088 | Switchgrass Rhizosphere | AAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMSCGGSRW |
| Ga0207683_101152591 | 3300026121 | Miscanthus Rhizosphere | TPACWSWAAGERIKLLAGDWNGRCAYAVFYNFYRRSTCEMSCGGSRW |
| Ga0209474_104128951 | 3300026550 | Soil | TPACFSWAAGERIALIAGDWHGRCIDAVFYNFARRSTCETWCH |
| Ga0179587_109902862 | 3300026557 | Vadose Zone Soil | ARTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCEVWCGGGGWW |
| Ga0209799_10262622 | 3300027654 | Tropical Forest Soil | RLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW |
| Ga0209689_10052588 | 3300027748 | Soil | RIRLIAGDWNGRCVAALFYNFYRRNTCEVWCGGGGWW |
| Ga0209481_104708652 | 3300027880 | Populus Rhizosphere | GMSPACFNWVAGERITLIAGDWNARCVGAVFYNFARRNRCEMLCGWRW |
| Ga0307276_100787521 | 3300028705 | Soil | TPACFSWVAGERITLVAGDWNAHCVVAVFYNFYRRNTCEMWCGGGGWW |
| Ga0307291_10665251 | 3300028707 | Soil | AAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW |
| Ga0307317_100276304 | 3300028720 | Soil | RSPACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW |
| Ga0307319_100544651 | 3300028722 | Soil | AGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMLCGGSRW |
| Ga0307299_100421511 | 3300028793 | Soil | KSRACFNWAAGERIKLIAGDWNARCTEAVFYNFYRRSTCEMWCRPW |
| Ga0307310_105030481 | 3300028824 | Soil | SWAAGERIKLLAGNWNARCDYAVFYNLYRRSTCEMWCGGSRW |
| Ga0170824_1158190621 | 3300031231 | Forest Soil | PACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMSCGGSRW |
| Ga0170818_1008905611 | 3300031474 | Forest Soil | PACWSWAAGERIKLLAGDWNARCDYAVFYNFYRRSTCEMWCGGSRW |
| Ga0318534_104258261 | 3300031544 | Soil | IRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318534_107169601 | 3300031544 | Soil | FTALTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318571_103561271 | 3300031549 | Soil | LIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318528_100329151 | 3300031561 | Soil | FTARTPACFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW |
| Ga0318555_104965441 | 3300031640 | Soil | RLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318560_105121601 | 3300031682 | Soil | RTPACFSWAAGERIGLIAGDWHARCVDAVFYNFSRRSTCETWCR |
| Ga0306917_101351633 | 3300031719 | Soil | ERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0307469_117727302 | 3300031720 | Hardwood Forest Soil | TGWAPACFRWVAGERIRLIAGDWNGRCIGAIFYNYARRNRCEMWCGW |
| Ga0318500_100454613 | 3300031724 | Soil | PSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0306918_110511951 | 3300031744 | Soil | ERIRLIAGDWNGRCVDARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318554_105178422 | 3300031765 | Soil | CISWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318526_100436761 | 3300031769 | Soil | LIGGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318547_100028716 | 3300031781 | Soil | TPACFSWAAGERIRLLAGDWNGRCVTAVFYNFYRRSTCEMWCGGSWWW |
| Ga0318529_101510201 | 3300031792 | Soil | RLSAGDWNGRCVAARFYNFYRRDTCDVWCGSGGWW |
| Ga0318548_104363371 | 3300031793 | Soil | AAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318567_108991951 | 3300031821 | Soil | SCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0306919_104811801 | 3300031879 | Soil | IRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW |
| Ga0306919_109724171 | 3300031879 | Soil | RIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0306925_107710931 | 3300031890 | Soil | AAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW |
| Ga0318522_104043312 | 3300031894 | Soil | TRFTALTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318520_110923992 | 3300031897 | Soil | RIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW |
| Ga0310910_108191752 | 3300031946 | Soil | FSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0310909_115161982 | 3300031947 | Soil | ATAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWW |
| Ga0318532_103037411 | 3300032051 | Soil | LSAGDWNGRCVAARFYNFYRRYTCDVWCGSGGWWW |
| Ga0318506_102776292 | 3300032052 | Soil | RTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRDTCDVWCGSGGWW |
| Ga0318575_101409621 | 3300032055 | Soil | TPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318504_100624223 | 3300032063 | Soil | HQRRPLHGATAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318525_101255431 | 3300032089 | Soil | TALTPSCFSWAAGERIRLIAGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318518_102574252 | 3300032090 | Soil | RIRLIVGDWNGRCVAARFYNFYRRNTCDVWCGSGGWWW |
| Ga0318519_100802641 | 3300033290 | Soil | FTARTPACFSWAAGERIRLLAGDWNGRCVTAVFYNFYRRSTCEMWCGGSWWW |
| Ga0326726_123265191 | 3300033433 | Peat Soil | AAGERIRLVAGDWNGQCVDAVFYNVWRRSTCEMWCRAWW |
| Ga0247830_111087561 | 3300033551 | Soil | FVGQTPACWSWAAGERIKLLAGDWNGRCDYAVFYNFYRRSTCEMLCGGSRW |
| ⦗Top⦘ |