


| Basic Information | |
|---|---|
| Family ID | F089394 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTVRDMLTALQTLPRDAELLAFEAGCEDYCEREVDDYLAS |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.04 % |
| % of genes near scaffold ends (potentially truncated) | 64.22 % |
| % of genes from short scaffolds (< 2000 bps) | 87.16 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.468 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.853 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.275 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF13602 | ADH_zinc_N_2 | 4.59 |
| PF02899 | Phage_int_SAM_1 | 2.75 |
| PF13489 | Methyltransf_23 | 1.83 |
| PF12680 | SnoaL_2 | 1.83 |
| PF02371 | Transposase_20 | 1.83 |
| PF00211 | Guanylate_cyc | 1.83 |
| PF00144 | Beta-lactamase | 1.83 |
| PF02796 | HTH_7 | 1.83 |
| PF08241 | Methyltransf_11 | 1.83 |
| PF03641 | Lysine_decarbox | 0.92 |
| PF13185 | GAF_2 | 0.92 |
| PF04892 | VanZ | 0.92 |
| PF00106 | adh_short | 0.92 |
| PF08271 | TF_Zn_Ribbon | 0.92 |
| PF13561 | adh_short_C2 | 0.92 |
| PF01329 | Pterin_4a | 0.92 |
| PF08281 | Sigma70_r4_2 | 0.92 |
| PF01569 | PAP2 | 0.92 |
| PF12902 | Ferritin-like | 0.92 |
| PF01243 | Putative_PNPOx | 0.92 |
| PF01966 | HD | 0.92 |
| PF01494 | FAD_binding_3 | 0.92 |
| PF03640 | Lipoprotein_15 | 0.92 |
| PF00872 | Transposase_mut | 0.92 |
| PF00589 | Phage_integrase | 0.92 |
| PF14230 | DUF4333 | 0.92 |
| PF13551 | HTH_29 | 0.92 |
| PF00296 | Bac_luciferase | 0.92 |
| PF06689 | zf-C4_ClpX | 0.92 |
| PF12681 | Glyoxalase_2 | 0.92 |
| PF01872 | RibD_C | 0.92 |
| PF00465 | Fe-ADH | 0.92 |
| PF02687 | FtsX | 0.92 |
| PF13340 | DUF4096 | 0.92 |
| PF08240 | ADH_N | 0.92 |
| PF01863 | YgjP-like | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 2.75 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 2.75 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.83 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.83 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.83 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.83 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.83 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.83 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.92 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.92 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.92 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.92 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.92 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.92 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.92 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.92 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.92 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.92 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.92 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.92 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.92 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.92 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.47 % |
| Unclassified | root | N/A | 38.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig814081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1023 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig935921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300000754|JGI11851J11668_1003111 | Not Available | 688 | Open in IMG/M |
| 3300000858|JGI10213J12805_10296638 | Not Available | 617 | Open in IMG/M |
| 3300000956|JGI10216J12902_100408702 | Not Available | 708 | Open in IMG/M |
| 3300000956|JGI10216J12902_102950851 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
| 3300000956|JGI10216J12902_104334667 | Not Available | 723 | Open in IMG/M |
| 3300001431|F14TB_100326320 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300003373|JGI25407J50210_10008554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2582 | Open in IMG/M |
| 3300003373|JGI25407J50210_10034829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1298 | Open in IMG/M |
| 3300005562|Ga0058697_10047297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces atratus | 1637 | Open in IMG/M |
| 3300005562|Ga0058697_10240527 | Not Available | 839 | Open in IMG/M |
| 3300005562|Ga0058697_10398645 | Not Available | 682 | Open in IMG/M |
| 3300005719|Ga0068861_100746499 | Not Available | 914 | Open in IMG/M |
| 3300005981|Ga0081538_10003151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 15679 | Open in IMG/M |
| 3300006169|Ga0082029_1168741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli | 840 | Open in IMG/M |
| 3300009156|Ga0111538_10551728 | Not Available | 1461 | Open in IMG/M |
| 3300009789|Ga0126307_10217440 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300009789|Ga0126307_11003268 | Not Available | 675 | Open in IMG/M |
| 3300009810|Ga0105088_1036285 | Not Available | 807 | Open in IMG/M |
| 3300009840|Ga0126313_10003680 | All Organisms → cellular organisms → Bacteria | 8874 | Open in IMG/M |
| 3300009840|Ga0126313_10598764 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300009840|Ga0126313_11167357 | Not Available | 634 | Open in IMG/M |
| 3300009840|Ga0126313_11393155 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010029|Ga0105074_1020925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1083 | Open in IMG/M |
| 3300010036|Ga0126305_10113629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1643 | Open in IMG/M |
| 3300010037|Ga0126304_10429068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 884 | Open in IMG/M |
| 3300010038|Ga0126315_10246038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1090 | Open in IMG/M |
| 3300010038|Ga0126315_10477238 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300010038|Ga0126315_11084080 | Not Available | 540 | Open in IMG/M |
| 3300010041|Ga0126312_10197098 | Not Available | 1407 | Open in IMG/M |
| 3300010041|Ga0126312_10431780 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300010041|Ga0126312_11347448 | Not Available | 529 | Open in IMG/M |
| 3300010045|Ga0126311_10120373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis | 1831 | Open in IMG/M |
| 3300010045|Ga0126311_10402058 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300010145|Ga0126321_1276515 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300010145|Ga0126321_1352689 | Not Available | 516 | Open in IMG/M |
| 3300010145|Ga0126321_1462145 | Not Available | 600 | Open in IMG/M |
| 3300010166|Ga0126306_10138859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1795 | Open in IMG/M |
| 3300010166|Ga0126306_10949345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300010166|Ga0126306_10955255 | Not Available | 697 | Open in IMG/M |
| 3300010395|Ga0058701_10554932 | Not Available | 643 | Open in IMG/M |
| 3300011003|Ga0138514_100101757 | Not Available | 623 | Open in IMG/M |
| 3300012021|Ga0120192_10000132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 5215 | Open in IMG/M |
| 3300012021|Ga0120192_10031975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 876 | Open in IMG/M |
| 3300012204|Ga0137374_10843608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
| 3300012211|Ga0137377_10486900 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300012355|Ga0137369_10229344 | Not Available | 1417 | Open in IMG/M |
| 3300012360|Ga0137375_11446405 | Not Available | 508 | Open in IMG/M |
| 3300012941|Ga0162652_100053035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 663 | Open in IMG/M |
| 3300013306|Ga0163162_11778976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidiphila | 704 | Open in IMG/M |
| 3300014487|Ga0182000_10001188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4878 | Open in IMG/M |
| 3300014487|Ga0182000_10067922 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300014487|Ga0182000_10375536 | Not Available | 622 | Open in IMG/M |
| 3300017965|Ga0190266_10575008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora → Catellatospora citrea | 675 | Open in IMG/M |
| 3300018051|Ga0184620_10031936 | Not Available | 1388 | Open in IMG/M |
| 3300018075|Ga0184632_10215751 | Not Available | 843 | Open in IMG/M |
| 3300018422|Ga0190265_11044042 | Not Available | 938 | Open in IMG/M |
| 3300018422|Ga0190265_11571173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300018466|Ga0190268_12064119 | Not Available | 527 | Open in IMG/M |
| 3300019377|Ga0190264_12093527 | Not Available | 523 | Open in IMG/M |
| 3300027277|Ga0209846_1004410 | Not Available | 2459 | Open in IMG/M |
| 3300027718|Ga0209795_10132037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300027809|Ga0209574_10123698 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300028712|Ga0307285_10012970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1824 | Open in IMG/M |
| 3300028717|Ga0307298_10244043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300028719|Ga0307301_10153637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 741 | Open in IMG/M |
| 3300028721|Ga0307315_10273142 | Not Available | 533 | Open in IMG/M |
| 3300028771|Ga0307320_10086525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1182 | Open in IMG/M |
| 3300028771|Ga0307320_10470606 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300028778|Ga0307288_10029451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1806 | Open in IMG/M |
| 3300028793|Ga0307299_10156782 | Not Available | 857 | Open in IMG/M |
| 3300028793|Ga0307299_10251926 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300028807|Ga0307305_10305607 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300028811|Ga0307292_10027617 | Not Available | 2037 | Open in IMG/M |
| 3300028811|Ga0307292_10060011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300028814|Ga0307302_10576991 | Not Available | 559 | Open in IMG/M |
| 3300028814|Ga0307302_10642685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300028819|Ga0307296_10212567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
| 3300028878|Ga0307278_10001284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12521 | Open in IMG/M |
| 3300028878|Ga0307278_10360344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300028880|Ga0307300_10040794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1292 | Open in IMG/M |
| 3300028880|Ga0307300_10293733 | Not Available | 549 | Open in IMG/M |
| 3300028881|Ga0307277_10561712 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300028884|Ga0307308_10168624 | Not Available | 1049 | Open in IMG/M |
| 3300030496|Ga0268240_10135202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300030499|Ga0268259_10027022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
| 3300031548|Ga0307408_100261945 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300031731|Ga0307405_10033470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3049 | Open in IMG/M |
| 3300031852|Ga0307410_10102297 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
| 3300031901|Ga0307406_11023703 | Not Available | 709 | Open in IMG/M |
| 3300031901|Ga0307406_11128695 | Not Available | 678 | Open in IMG/M |
| 3300031901|Ga0307406_12072553 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031903|Ga0307407_10858427 | Not Available | 694 | Open in IMG/M |
| 3300031911|Ga0307412_10410636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1105 | Open in IMG/M |
| 3300031911|Ga0307412_11186644 | Not Available | 683 | Open in IMG/M |
| 3300031911|Ga0307412_12038262 | Not Available | 532 | Open in IMG/M |
| 3300031995|Ga0307409_100972973 | Not Available | 866 | Open in IMG/M |
| 3300032002|Ga0307416_100009005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6494 | Open in IMG/M |
| 3300032002|Ga0307416_101781677 | Not Available | 720 | Open in IMG/M |
| 3300032004|Ga0307414_10079179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2398 | Open in IMG/M |
| 3300032005|Ga0307411_10164021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1668 | Open in IMG/M |
| 3300032126|Ga0307415_100062552 | All Organisms → cellular organisms → Bacteria | 2582 | Open in IMG/M |
| 3300032126|Ga0307415_100232149 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300032126|Ga0307415_102151905 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032159|Ga0268251_10077575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1144 | Open in IMG/M |
| 3300033550|Ga0247829_11272102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 609 | Open in IMG/M |
| 3300033551|Ga0247830_11089096 | Not Available | 638 | Open in IMG/M |
| 3300034172|Ga0334913_043811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces ferrugineus | 955 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 17.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 16.51% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 6.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.67% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.75% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.75% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.83% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.92% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000754 | Amended soil microbial communities from Kansas Great Prairies, USA - acetate Total DNA F2.4TB | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_09669010 | 2124908045 | Soil | EMLTALQTLPRDAELLAFEAGCEDYCEREVDDYLAS |
| KansclcFeb2_15182190 | 2124908045 | Soil | LLATLQRLPKDLEVLAFEAGCEEYCEREVDEVEWDDEAAE |
| JGI11851J11668_10031111 | 3300000754 | Soil | MTVRDLLTALQALPRDAELLAFEAGCEDYCEREVDEVEWQGVRVY |
| JGI10213J12805_102966381 | 3300000858 | Soil | MTVREFLAELQRLPRDAEVLAFEAGCEDYCEREIDDYLTC* |
| JGI10216J12902_1004087021 | 3300000956 | Soil | MTVRDLLTMLQRLPRDAELLAFDAGWEDYCEREMDDYLAS* |
| JGI10216J12902_1029508515 | 3300000956 | Soil | MTLREALAELQRLPRNAELLAFEPGYEEYCEREVDGYLAS* |
| JGI10216J12902_1043346672 | 3300000956 | Soil | MTVREMLAELQRLLRDAELLAFEAGCEDYCERELD |
| F14TB_1003263202 | 3300001431 | Soil | MLTALQTLLDAELLAFEAGEDYGEREVDEVEWQGGRVY |
| JGI25407J50210_100085542 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MTVRDLLTALQRLPRDVGMLAMKAGCEHYCEQEVDYVEL* |
| JGI25407J50210_100348293 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MTVREVLAELQHLPRDAEVLAFEAGCEEFCEREVDEVEVQGGRV |
| Ga0058697_100472972 | 3300005562 | Agave | FPQGASSLQHLPRDLEVLAFEAGCQDYCEREVDEVE* |
| Ga0058697_102405271 | 3300005562 | Agave | MTVRDLLTELQHLPRDLEVLAFEAGCEDYCEREVDELELQGGR |
| Ga0058697_103986452 | 3300005562 | Agave | MTVRDMLTALQALPRNAELLAFEAGCEDYCEREVDEVEW |
| Ga0068861_1007464993 | 3300005719 | Switchgrass Rhizosphere | MTVREMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGGRV |
| Ga0081538_100031516 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTVKDMLIALQALPRHAELLAFEAGCEDYCEREVDDYLAS* |
| Ga0082029_11687412 | 3300006169 | Termite Nest | MLAVLQRFLGGAELLAFEAGCKDYCEREVDEVEWQGGPVYLSRR* |
| Ga0111538_105517281 | 3300009156 | Populus Rhizosphere | MTVREFLAELQHLPRDAEVLAFEAGCKEYCEREIDDCLAF* |
| Ga0126307_102174402 | 3300009789 | Serpentine Soil | MLTALQTLPRNAELLAFKAGCYHSEDYREREVDDYLAS* |
| Ga0126307_110032683 | 3300009789 | Serpentine Soil | MTVRDLLATLQRLPKDAELLAFEAGCEDYCEREVDEVEWQDGRV* |
| Ga0105088_10362852 | 3300009810 | Groundwater Sand | MTVRDMLTALQMLPRDAELLAFEAGCEDYCEREVDEVEWQG |
| Ga0126313_1000368012 | 3300009840 | Serpentine Soil | MTVRELLAELQHLPRDLEVLAFEAGCEEYCEREVDDYLAC* |
| Ga0126313_105987641 | 3300009840 | Serpentine Soil | MTVRELLTELQHLPRDLEVLVFEAGCEDYCEREVDE |
| Ga0126313_111673572 | 3300009840 | Serpentine Soil | MTVGELVVRLQRLPREAELLAMEPGCEEYCEREVDDYLAF* |
| Ga0126313_113931552 | 3300009840 | Serpentine Soil | MLTALQRLPRDAEVLAMEAGCDQYCEIELDDYLAF* |
| Ga0105074_10209253 | 3300010029 | Groundwater Sand | LLTALQVLPRDAELLAFAAGCEDYCERDVDEVEWQGGRVELHL |
| Ga0126305_101136291 | 3300010036 | Serpentine Soil | MTVREMLTALQMLPRDAELLAFEAGCEDYCEREIDDYLAS* |
| Ga0126304_104290681 | 3300010037 | Serpentine Soil | RYAGWMTVREMLTALQMLPRDAEVLAFEAGCEDYCEREVDDYLAS* |
| Ga0126315_102460382 | 3300010038 | Serpentine Soil | MLTALQTLPRDAELLAFEAGCEDYCEREVDEVEWQGGRVFLHL |
| Ga0126315_104772382 | 3300010038 | Serpentine Soil | LAELQHLPRDLEVLAFEAGCEDYCEREVDDYLAS* |
| Ga0126315_110840801 | 3300010038 | Serpentine Soil | MIVRDLLTELQHLPRDLEILAFEAGCEAYCEREVDE |
| Ga0126312_101970981 | 3300010041 | Serpentine Soil | MLTALQNAPRDAELLAFEAGCEDYCEREVDEVEWQGDR |
| Ga0126312_104317801 | 3300010041 | Serpentine Soil | DLLATLQRLPKDAELLAFEAGCEAYCEREVDDYLAC* |
| Ga0126312_113474481 | 3300010041 | Serpentine Soil | MTVREFLTELQRLPRDAEVLAFEAGCEDYCEREVDDYLAS* |
| Ga0126311_101203732 | 3300010045 | Serpentine Soil | MLTALQVLPRDAELLAFEAGCEDYCEREVDDYLAS* |
| Ga0126311_104020582 | 3300010045 | Serpentine Soil | MTVRDLLTVLRTFPGDAELLAFEAGCEDYCEREVDEME* |
| Ga0126321_12765151 | 3300010145 | Soil | LLANLQRLPRHLEVLAFEAGCDDYCEREVDDYLAS* |
| Ga0126321_13526892 | 3300010145 | Soil | LAELQRLLRDAEVLAFEAGCEEYCEREVDDYLAS* |
| Ga0126321_14621451 | 3300010145 | Soil | MLTALQTLPRDAELLAFEADCEDYCEREVDEIEW* |
| Ga0126306_101388591 | 3300010166 | Serpentine Soil | QLPLGMTVRRMLTRLQHLPQDTEVLAFEPGCEEYCEREVDDYLAS* |
| Ga0126306_109493451 | 3300010166 | Serpentine Soil | MTVREMLAELQYLLRDAELLAFEAGCEDYCERELDDYLAS* |
| Ga0126306_109552552 | 3300010166 | Serpentine Soil | MTVREMLLALQTLPRDAELLAFEAGCEDYCEREVDEVEW |
| Ga0058701_105549321 | 3300010395 | Agave | GRLAGYARHMTVGDMLATLQRLPRDAELLAFEPGCQDDGEREVDELELQGDRV* |
| Ga0138514_1001017571 | 3300011003 | Soil | MLTALQTLPRDAELLAFEAGCEDYCERELDEVEWQGGRVYLH |
| Ga0120192_100001321 | 3300012021 | Terrestrial | MLTALQLLPRDAELLAFEAGGEDYCEREVDEVEWQGGRGDLHPGV |
| Ga0120192_100319752 | 3300012021 | Terrestrial | MTVREFLTELQRLPRDAEGLAFEAGCEEYCEREIDDNLAS* |
| Ga0137374_108436081 | 3300012204 | Vadose Zone Soil | RMMVRDLVAALQRLPKDAELLAFEPGCEDYCEREIDDCLAEASGT* |
| Ga0137377_104869002 | 3300012211 | Vadose Zone Soil | MTVHELTSRLLRLPRDAEVLAFEPGCEQYFEREVDDV |
| Ga0137369_102293442 | 3300012355 | Vadose Zone Soil | MTVRELLAELQHLPRDLEVLAFEAGCEDYCERELDELDL |
| Ga0137375_114464052 | 3300012360 | Vadose Zone Soil | MTVREFLAELQRLPRDAEVLAFEAGCEDYCEREIDEVEVQGG |
| Ga0162652_1000530351 | 3300012941 | Soil | MLTALQTLPRDAELLAFEAGCENYCEREVDEVEWKGGRADSP* |
| Ga0163162_117789761 | 3300013306 | Switchgrass Rhizosphere | MLTALQAFPRDAELLAFEAGCEDYREREVDVYLAS* |
| Ga0182000_100011886 | 3300014487 | Soil | MTVRDLLTELQHLPRDLEVLAFEAGCEDYCEREVDELEL |
| Ga0182000_100679221 | 3300014487 | Soil | MLTVLQTLPRDAELLAFEAGCEDYCEREVDELELQGGR |
| Ga0182000_103755363 | 3300014487 | Soil | MTVRDLLATLQRLPKDAELLAFEAGCEDYCGREVDEV |
| Ga0190266_105750082 | 3300017965 | Soil | MTVRDLLTALQALPRDAELLAFEAGCEDYCEREVDDYLAS |
| Ga0184620_100319361 | 3300018051 | Groundwater Sediment | EMLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGSRV |
| Ga0184632_102157511 | 3300018075 | Groundwater Sediment | MTVQDMLTALQRLPRDAEVLAFEAGCEEYCEREVDEV |
| Ga0190265_110440423 | 3300018422 | Soil | MTVRELLAELQHLPRDLEVLAFEAGCEDYCEREVDDLEF |
| Ga0190265_115711731 | 3300018422 | Soil | MTVRELLAELQHLPRDLEVLAFEVGCEDYCVPCRTR |
| Ga0190268_120641191 | 3300018466 | Soil | GRMTVRDMLIRLQTLPRDAELLAFEAGCEDYCEREVDDYLAS |
| Ga0190264_120935271 | 3300019377 | Soil | MTGRELLAELQHLPRDLEVLAFEAGCEDYCEREIDELELQG |
| Ga0209846_10044104 | 3300027277 | Groundwater Sand | MTVGELLVRMQRLPRDAELLAMEPGCEEYCEREVDEVEWQVFSA |
| Ga0209795_101320371 | 3300027718 | Agave | MLTALQTLPRDAELLASEADCEDYREREVDEIEWQGDWVYLHLGC |
| Ga0209574_101236981 | 3300027809 | Agave | MLTALQRLPRDAEVLGMEAGCEPYCEIELDDVKLQGDRVYLHPRGSA |
| Ga0307285_100129705 | 3300028712 | Soil | MLTALQTLPRDAELLAFEGGCENYCEREVDEVEWQG |
| Ga0307298_102440432 | 3300028717 | Soil | MTVRDLLATLQRLPKDIEVLAFEAACEDYCEREVDDYLACQ |
| Ga0307301_101536372 | 3300028719 | Soil | RDMLTALQTLPRDAELLAFEDGSEDYCEREVDDHLGPSEMAAP |
| Ga0307315_102731421 | 3300028721 | Soil | MLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGG |
| Ga0307320_100865251 | 3300028771 | Soil | MTARDMLTALQTLPRDAELLAFEDGSEDYCEREVDDHLGPSEMAAP |
| Ga0307320_104706062 | 3300028771 | Soil | HMTVRDMLTALQALLRDAELLAFEAGCEDYCEREVDDYQAF |
| Ga0307288_100294512 | 3300028778 | Soil | MLTALQTLPRDAELLAFEAGCKDYCEREVDEVEWQGDRV |
| Ga0307299_101567822 | 3300028793 | Soil | MTVRELLAELQHLPRDLEVLAFEAGCEDYCEREVDELEF |
| Ga0307299_102519261 | 3300028793 | Soil | MLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQ |
| Ga0307305_103056071 | 3300028807 | Soil | MLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGGRVYL |
| Ga0307292_100276171 | 3300028811 | Soil | MTVRDMLTALQTLPRDAELLAFEAGCEDYCEREVDDYLAS |
| Ga0307292_100600113 | 3300028811 | Soil | MTVRDLLATLQRLPKDIEVLAFEAACEDYCEREVDEV |
| Ga0307302_105769911 | 3300028814 | Soil | MTVRELLAELQHLPRDLEVLAFEAGCEDYCEREVDELELQGGRV |
| Ga0307302_106426852 | 3300028814 | Soil | MTVRDLLATLQRLPKDIEVLAFEAACEDYCEREVDEVEWQGGR |
| Ga0307296_102125672 | 3300028819 | Soil | MTVQDLLTALQRLPRDAEPLAFEPGCEEYCEREIDDYLAC |
| Ga0307278_100012845 | 3300028878 | Soil | MLTALQTLPRDAELLAFEAGCEDYCEREVDDYLAS |
| Ga0307278_103603441 | 3300028878 | Soil | MTVRDMLTALQVLPRDAELLAFQAGCEDYCEREVDDY |
| Ga0307300_100407943 | 3300028880 | Soil | MLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGGRVYLHLG |
| Ga0307300_102937332 | 3300028880 | Soil | ASSPGGITVRELLATLQQLPRDTEVLVFEPGCEEYCECEVDEVEL |
| Ga0307277_105617122 | 3300028881 | Soil | MTVPDLLATLQRLPKDIEVLAFEAACEDYCEDYCEREVDEI |
| Ga0307308_101686242 | 3300028884 | Soil | MTVRELLAALQRLLRDGEVVAFEPGCEEYCEREVDDYLAS |
| Ga0268240_101352021 | 3300030496 | Soil | MTVRDMLTALQTLPRDAELLAFEAGCEDYCEREIHEVEWQRGRVY |
| Ga0268259_100270221 | 3300030499 | Agave | MTVRELLAQLQHLPRDLEVLAFEAGCEDYCEREVDE |
| Ga0307408_1002619452 | 3300031548 | Rhizosphere | MTVRDLLTGLQHLPRDLEVLTFEAGCEDYCEREVDDYLAS |
| Ga0307405_100334704 | 3300031731 | Rhizosphere | MTVRELLAELQHLPRDLEVLAFEAGCEEYCEREVDDYLAC |
| Ga0307410_101022973 | 3300031852 | Rhizosphere | VRDLLTGLQHLPRDLEVLTFEAGCEDYCEREVDDYLAS |
| Ga0307406_110237031 | 3300031901 | Rhizosphere | MTVREFLAGLQHLPRDAEVLAFEAGCEEYCEREVDEVEVQGG |
| Ga0307406_111286952 | 3300031901 | Rhizosphere | MTVREMLLALQTLPRDAELLAFEAGCEDYCEREVDDYLAS |
| Ga0307406_120725532 | 3300031901 | Rhizosphere | MTVRDLLTELQHLPRDLEVLTFEAGCEDHCEREVDELRLQD |
| Ga0307407_108584272 | 3300031903 | Rhizosphere | MLTALQVLPRDAELLAFEAGCEDYCEREVDDYLAS |
| Ga0307412_104106362 | 3300031911 | Rhizosphere | MTVREFLAELQHLPRDAEVLAFEAGCEDYCEREIDEV |
| Ga0307412_111866441 | 3300031911 | Rhizosphere | MTVRDMLTALQTLPREAELLAFEAGCEDYCEREVDE |
| Ga0307412_120382621 | 3300031911 | Rhizosphere | MTVREFLAELQHLPRDAEVLAFEAGCEDYCEREIDEVE |
| Ga0307409_1009729731 | 3300031995 | Rhizosphere | MTVRDMLTALQTLPRDAELLAFEAGCEDYCEREVDEVQWQ |
| Ga0307416_1000090059 | 3300032002 | Rhizosphere | MTVRELLAQLQHLPRDLEVLAFEAGCEDYCEREVDELEL |
| Ga0307416_1017816771 | 3300032002 | Rhizosphere | MTVRELLAELQLLPRDLEVLAFEAGCEDYCEREVDDYLVS |
| Ga0307414_100791792 | 3300032004 | Rhizosphere | MTVRDLLTGLQHLPRDLEVLTFEAGCKDYCEREVDDYLAS |
| Ga0307411_101640212 | 3300032005 | Rhizosphere | MTVREMLTALQVLPRDAELLAFEAGCEDYCEREVDDYLAS |
| Ga0307415_1000625523 | 3300032126 | Rhizosphere | MTVKEFLAQLQHLPRDAEVLAFEAGCEEYCEREIDDYLAS |
| Ga0307415_1002321491 | 3300032126 | Rhizosphere | MTVRDLLATLQRLPKDAELLAFEAGCEDYCEREVDDYLAS |
| Ga0307415_1021519051 | 3300032126 | Rhizosphere | MLTALQTLPRDAELLAFEAGCEDYCEREVDEVEWQ |
| Ga0268251_100775753 | 3300032159 | Agave | MHDSRDQVAQLQHLPRDLEVLAFEADCEDYCEREADELALQGGRVYLH |
| Ga0247829_112721022 | 3300033550 | Soil | TLPRDAELLALEAGCENYCEREVDEVEWKGGRADSPRG |
| Ga0247830_110890961 | 3300033551 | Soil | MLASLQRLPRDAELLAFEAGCEDYCEREVDEVEWQGGRVY |
| Ga0334913_043811_789_911 | 3300034172 | Sub-Biocrust Soil | MTVRELLAELQQLPRDAELLAFEPGCQDYCEREVDDYLVC |
| ⦗Top⦘ |