


| Basic Information | |
|---|---|
| Family ID | F089371 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDIESE |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.50 % |
| % of genes near scaffold ends (potentially truncated) | 93.58 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.349 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.367 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF16798 | DUF5069 | 36.70 |
| PF00355 | Rieske | 8.26 |
| PF00848 | Ring_hydroxyl_A | 5.50 |
| PF03734 | YkuD | 2.75 |
| PF01494 | FAD_binding_3 | 1.83 |
| PF03301 | Trp_dioxygenase | 1.83 |
| PF13676 | TIR_2 | 0.92 |
| PF00497 | SBP_bac_3 | 0.92 |
| PF06841 | Phage_T4_gp19 | 0.92 |
| PF13577 | SnoaL_4 | 0.92 |
| PF00282 | Pyridoxal_deC | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 11.01 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.67 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 2.75 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 2.75 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.83 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.83 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.83 |
| COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 1.83 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.25 % |
| Unclassified | root | N/A | 2.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459006|GBPF9FW01BTFD0 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 508 | Open in IMG/M |
| 2170459006|GBPF9FW01CKN3K | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 504 | Open in IMG/M |
| 2170459009|GA8DASG01CYFID | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 512 | Open in IMG/M |
| 3300000890|JGI11643J12802_10989359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 775 | Open in IMG/M |
| 3300000890|JGI11643J12802_11238510 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1490 | Open in IMG/M |
| 3300001139|JGI10220J13317_10026039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 605 | Open in IMG/M |
| 3300003659|JGI25404J52841_10005809 | All Organisms → cellular organisms → Bacteria | 2557 | Open in IMG/M |
| 3300004114|Ga0062593_101235675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 787 | Open in IMG/M |
| 3300004463|Ga0063356_104358622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 609 | Open in IMG/M |
| 3300004479|Ga0062595_100129122 | Not Available | 1420 | Open in IMG/M |
| 3300005162|Ga0066814_10112617 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 520 | Open in IMG/M |
| 3300005179|Ga0066684_10939524 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
| 3300005293|Ga0065715_10446061 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 831 | Open in IMG/M |
| 3300005334|Ga0068869_101956244 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 526 | Open in IMG/M |
| 3300005337|Ga0070682_100542149 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 909 | Open in IMG/M |
| 3300005434|Ga0070709_10274945 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300005439|Ga0070711_100839727 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 781 | Open in IMG/M |
| 3300005547|Ga0070693_100621953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 782 | Open in IMG/M |
| 3300005558|Ga0066698_11014091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
| 3300005568|Ga0066703_10161000 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300005569|Ga0066705_10051844 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300005586|Ga0066691_10187037 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300005764|Ga0066903_106776646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 595 | Open in IMG/M |
| 3300005993|Ga0080027_10450974 | Not Available | 521 | Open in IMG/M |
| 3300006046|Ga0066652_100380775 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1279 | Open in IMG/M |
| 3300006172|Ga0075018_10520458 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 623 | Open in IMG/M |
| 3300006175|Ga0070712_100280139 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1343 | Open in IMG/M |
| 3300006176|Ga0070765_102117705 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300007788|Ga0099795_10340945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 668 | Open in IMG/M |
| 3300009038|Ga0099829_10772320 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 798 | Open in IMG/M |
| 3300009137|Ga0066709_101355390 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300009553|Ga0105249_12065744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 643 | Open in IMG/M |
| 3300009792|Ga0126374_11628935 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 534 | Open in IMG/M |
| 3300010048|Ga0126373_12441927 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 582 | Open in IMG/M |
| 3300010301|Ga0134070_10373263 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 557 | Open in IMG/M |
| 3300010320|Ga0134109_10406504 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
| 3300010322|Ga0134084_10269369 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300010358|Ga0126370_12147809 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 549 | Open in IMG/M |
| 3300010358|Ga0126370_12316293 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 532 | Open in IMG/M |
| 3300010362|Ga0126377_10411095 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300011119|Ga0105246_10271503 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300011270|Ga0137391_10871353 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 738 | Open in IMG/M |
| 3300012189|Ga0137388_11075575 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012202|Ga0137363_10004056 | All Organisms → cellular organisms → Bacteria | 8959 | Open in IMG/M |
| 3300012202|Ga0137363_10439779 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012202|Ga0137363_10610797 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012203|Ga0137399_11592342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 541 | Open in IMG/M |
| 3300012350|Ga0137372_10986627 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 589 | Open in IMG/M |
| 3300012353|Ga0137367_11080476 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 543 | Open in IMG/M |
| 3300012354|Ga0137366_10945521 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 603 | Open in IMG/M |
| 3300012356|Ga0137371_11202494 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 566 | Open in IMG/M |
| 3300012358|Ga0137368_10466521 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 818 | Open in IMG/M |
| 3300012923|Ga0137359_10088953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2720 | Open in IMG/M |
| 3300012923|Ga0137359_11421661 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 582 | Open in IMG/M |
| 3300012925|Ga0137419_11749324 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 531 | Open in IMG/M |
| 3300012929|Ga0137404_10788221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 863 | Open in IMG/M |
| 3300012951|Ga0164300_10368382 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 778 | Open in IMG/M |
| 3300012961|Ga0164302_10005729 | All Organisms → cellular organisms → Bacteria | 4507 | Open in IMG/M |
| 3300012988|Ga0164306_11597283 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 562 | Open in IMG/M |
| 3300014150|Ga0134081_10048871 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300014157|Ga0134078_10211421 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300015371|Ga0132258_12680565 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300015371|Ga0132258_13605106 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300015373|Ga0132257_103649097 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300015374|Ga0132255_105800989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 522 | Open in IMG/M |
| 3300016422|Ga0182039_11988056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 535 | Open in IMG/M |
| 3300017656|Ga0134112_10237136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 721 | Open in IMG/M |
| 3300018028|Ga0184608_10427093 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 573 | Open in IMG/M |
| 3300018078|Ga0184612_10188803 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1073 | Open in IMG/M |
| 3300019356|Ga0173481_10055635 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300019789|Ga0137408_1338914 | All Organisms → cellular organisms → Bacteria | 6902 | Open in IMG/M |
| 3300019865|Ga0193748_1008664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 900 | Open in IMG/M |
| 3300019868|Ga0193720_1026685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 823 | Open in IMG/M |
| 3300019885|Ga0193747_1137447 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 566 | Open in IMG/M |
| 3300019890|Ga0193728_1253044 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 703 | Open in IMG/M |
| 3300020001|Ga0193731_1046349 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300020018|Ga0193721_1054138 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1053 | Open in IMG/M |
| 3300020022|Ga0193733_1019398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1918 | Open in IMG/M |
| 3300021168|Ga0210406_11245502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 539 | Open in IMG/M |
| 3300021344|Ga0193719_10009662 | All Organisms → cellular organisms → Bacteria | 4031 | Open in IMG/M |
| 3300021475|Ga0210392_10443179 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 951 | Open in IMG/M |
| 3300021510|Ga0222621_1115317 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 571 | Open in IMG/M |
| 3300021560|Ga0126371_10225494 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300022534|Ga0224452_1287279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 502 | Open in IMG/M |
| 3300024186|Ga0247688_1101107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300025912|Ga0207707_11177329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 621 | Open in IMG/M |
| 3300025914|Ga0207671_11073953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 633 | Open in IMG/M |
| 3300025915|Ga0207693_10187898 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300025927|Ga0207687_10825685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 791 | Open in IMG/M |
| 3300026078|Ga0207702_10633269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1051 | Open in IMG/M |
| 3300026281|Ga0209863_10242000 | Not Available | 518 | Open in IMG/M |
| 3300026551|Ga0209648_10052303 | All Organisms → cellular organisms → Bacteria | 3493 | Open in IMG/M |
| 3300027882|Ga0209590_10277366 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300028379|Ga0268266_10168305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1987 | Open in IMG/M |
| 3300028379|Ga0268266_11094838 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 771 | Open in IMG/M |
| 3300028536|Ga0137415_10883946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 704 | Open in IMG/M |
| 3300028807|Ga0307305_10010581 | All Organisms → cellular organisms → Bacteria | 4053 | Open in IMG/M |
| 3300028875|Ga0307289_10422664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 548 | Open in IMG/M |
| 3300028881|Ga0307277_10204658 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 866 | Open in IMG/M |
| 3300030916|Ga0075386_12113691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 583 | Open in IMG/M |
| 3300030917|Ga0075382_11539114 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
| 3300031057|Ga0170834_106263237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 609 | Open in IMG/M |
| 3300031720|Ga0307469_10575263 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1002 | Open in IMG/M |
| 3300031720|Ga0307469_12483671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 506 | Open in IMG/M |
| 3300032064|Ga0318510_10188682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 829 | Open in IMG/M |
| 3300032180|Ga0307471_102096280 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 711 | Open in IMG/M |
| 3300032205|Ga0307472_100244975 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300033412|Ga0310810_10365995 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300033475|Ga0310811_10110172 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L01_03504680 | 2170459006 | Grass Soil | FLSTRTDPRQEVELEASRESDSKITQVEISLPLPKPNIESE |
| L01_04616480 | 2170459006 | Grass Soil | DPRQEVELEASREPDSKITQVEISLPLPKPNIESE |
| F47_01432450 | 2170459009 | Grass Soil | TCTDPRQEVELEASREPDSKITQVEISSPLPEPNIDSE |
| JGI11643J12802_109893591 | 3300000890 | Soil | DPRQEVELEASREPDSKITHVEISSPLPKPDIESE* |
| JGI11643J12802_112385104 | 3300000890 | Soil | KITRILFLSTRTDPRQEVELEASREPDSKVTQVEISCPLPKPEIASE* |
| JGI10220J13317_100260391 | 3300001139 | Soil | DPRLEVELEASREPDSNITQVEISSPLPKPDIENE* |
| JGI25404J52841_100058095 | 3300003659 | Tabebuia Heterophylla Rhizosphere | FLSTRTDPRQEVELEASREPDGKITHVEISSPLPKPNIDDE* |
| Ga0062593_1012356752 | 3300004114 | Soil | SSNGNLTTIMFLSTRTDPVQKVELDARRAPGEKISRIKISSPLFKPDETSE* |
| Ga0063356_1043586221 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LSTRTDPRQEVELEASREPDSKITHVEISSPLPKPDIVSE* |
| Ga0062595_1001291222 | 3300004479 | Soil | LSTRTDPRQEVEMEAKREAGGKITEVNISSPLPKPEAASD* |
| Ga0066814_101126171 | 3300005162 | Soil | KITRILFLSTRTDPRQEVELEASREPDSKITRIEISSPLPKPDIGSE* |
| Ga0066684_109395241 | 3300005179 | Soil | FLSTRTDPRQEVELEASREPDGKITQVEISSPLPKPEIASE* |
| Ga0065715_104460611 | 3300005293 | Miscanthus Rhizosphere | ILFLSTRTDPRQEVELEASREPDSKVTQIEISSPLPKPDIGSE* |
| Ga0068869_1019562441 | 3300005334 | Miscanthus Rhizosphere | LFLSTRTDPRQEVELEASREPESKVTQVEISSPLPKPGIGSE* |
| Ga0070682_1005421493 | 3300005337 | Corn Rhizosphere | TRILFLSTRTDPRQEVELEASREPGGKVTRIEIASPLPKPDIGSE* |
| Ga0070709_102749451 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | STRTDPRQEVELEASREPDSKVTQVEISSPLPKPDIGSE* |
| Ga0070711_1008397271 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TRILFLSTRTDPRQEVELEASREPESKVTQVEISSPLPKPEIGSE* |
| Ga0070693_1006219532 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LSTRTDPRQEVELEASREPGGKVTRIEIASPLPKPDIGSE* |
| Ga0066698_110140911 | 3300005558 | Soil | LSTRTDPRQEVELEASREPDNKITQVEISSPLPKPDIESE* |
| Ga0066703_101610003 | 3300005568 | Soil | NGKLTTIMFLSTRTDPVQEAKLEASREPGGKITQVEISSPLPKPDIGSE* |
| Ga0066705_100518444 | 3300005569 | Soil | KITRILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPVIESQ* |
| Ga0066691_101870373 | 3300005586 | Soil | FLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPVIESQ* |
| Ga0066903_1067766461 | 3300005764 | Tropical Forest Soil | STRTDPRQEVELEASREPDSKVTQVQISSPLPKPELGSE* |
| Ga0080027_104509742 | 3300005993 | Prmafrost Soil | VRNNISSNGNLTTIMFLSTRTDPVQKVEMDARRAPGEKISRVEISSPLPKPG |
| Ga0066652_1003807751 | 3300006046 | Soil | DPRQEVELEASREPDSKITKVEISSPLPKPDIESD* |
| Ga0075018_105204582 | 3300006172 | Watersheds | STRTDPRQEVELEASREPDSKITQVEISSPLPKPDIESE* |
| Ga0070712_1002801391 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | STRTDPRQEVELEASREPDGKITQVEISSPLPKPNIESE* |
| Ga0070765_1021177052 | 3300006176 | Soil | STRTDPRQEVELEASREPDGKITQVEISSPLPKPDIEGE* |
| Ga0099795_103409451 | 3300007788 | Vadose Zone Soil | NPVEKVELEASSEPNSKVTQVEISSPLPKPDIESE* |
| Ga0099829_107723202 | 3300009038 | Vadose Zone Soil | LFLSTRTDPRQEVELEASREADNKITQVEISSPLPKPDIESE* |
| Ga0066709_1013553901 | 3300009137 | Grasslands Soil | MNVNGKNTRILFLSTRTNPREKVELEASREADSKVTHAEISSPL |
| Ga0105249_120657441 | 3300009553 | Switchgrass Rhizosphere | RTDPRQEVELEASREPDGKITQIEISSPLPKPNIESE* |
| Ga0126374_116289351 | 3300009792 | Tropical Forest Soil | PRQEVELEASREPDSKITQVEISSPLPKPVVASE* |
| Ga0126373_124419271 | 3300010048 | Tropical Forest Soil | TRILFLSTRNDPREEVELEASREPGSKVTQVQISSPLPKPEIGSE* |
| Ga0134070_103732631 | 3300010301 | Grasslands Soil | KITRILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPNIDSE* |
| Ga0134109_104065041 | 3300010320 | Grasslands Soil | LFLSTRTDPRQEVELEASRDPDSKVTQVEISSPLPKPEIGSE* |
| Ga0134084_102693691 | 3300010322 | Grasslands Soil | LFLSTRTDPREEVELEASREPNGKITQVEISSALPKPDFGSE* |
| Ga0126370_121478091 | 3300010358 | Tropical Forest Soil | TNPGQEVELEASREKDSKVTQVAISSPPPKPDIGSE* |
| Ga0126370_123162931 | 3300010358 | Tropical Forest Soil | RILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDVASE* |
| Ga0126377_104110951 | 3300010362 | Tropical Forest Soil | DPRQEVELEASREPDAKITQVEISSPLPKPDIDTE* |
| Ga0105246_102715033 | 3300011119 | Miscanthus Rhizosphere | LSTRTDPRQEVELEASREPDSKVTQVQISSPLPKPEIGTE* |
| Ga0137391_108713532 | 3300011270 | Vadose Zone Soil | ILFLSTRTDPKQEVELEASREPGSKVTQVEISSPLPKPEIGSE* |
| Ga0137388_110755752 | 3300012189 | Vadose Zone Soil | STRSDPMQEVELEASREPDGKITQVEISSPLPKPDIESE* |
| Ga0137363_1000405611 | 3300012202 | Vadose Zone Soil | MFLSTRTDPLQEVKLEASREPGGKITQIEISFPLPKPDVQGE* |
| Ga0137363_104397791 | 3300012202 | Vadose Zone Soil | TRTDPRQEVELEASREPNSKVTQIQISSPLPKPEVGSE* |
| Ga0137363_106107971 | 3300012202 | Vadose Zone Soil | TDPRQEVELAASREQDSKITQVEISSPLPKPDIESE* |
| Ga0137399_115923421 | 3300012203 | Vadose Zone Soil | KITRILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDIGSE* |
| Ga0137372_109866272 | 3300012350 | Vadose Zone Soil | STRTDPRLEVELEASREPDSNITQVEISSPLPKPDIESE* |
| Ga0137367_110804761 | 3300012353 | Vadose Zone Soil | FLSTRTDPRQEVELEASREPDNKVTQIQISSPLPKPEIGSE* |
| Ga0137366_109455212 | 3300012354 | Vadose Zone Soil | FLSTRTDPRQEVELEASREPNNKVTQIQISSPLPKPEVGSE* |
| Ga0137371_112024942 | 3300012356 | Vadose Zone Soil | FLSTLTDLRQEVELEASREPDSKITQIEISSPLPKPDVESE* |
| Ga0137368_104665211 | 3300012358 | Vadose Zone Soil | ITRILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDIESE* |
| Ga0137359_100889531 | 3300012923 | Vadose Zone Soil | NGKLITITSLSTRSDPVQEVKLEASREADGKVTQVEISSPLPKPDIGSE* |
| Ga0137359_114216611 | 3300012923 | Vadose Zone Soil | PRQEVELEASREPDSKITQIEISSRLPKPDIESE* |
| Ga0137419_117493242 | 3300012925 | Vadose Zone Soil | TQTNPVEKVELEASREPNSKVTQVEISSPLPKPDIESE* |
| Ga0137404_107882211 | 3300012929 | Vadose Zone Soil | TDPRQEVELEASREPDGKITQVEISSPLPKPNIESE* |
| Ga0164300_103683822 | 3300012951 | Soil | NGKVTRILFLSTRTDPRQEVELEASREPESKVTQVEISSPLPKPEIGSE* |
| Ga0164302_100057291 | 3300012961 | Soil | GKLMTVTSLSTRSDPVQEVKLEASREADGKITQVEISSPLPKPNIETE* |
| Ga0164306_115972831 | 3300012988 | Soil | NGKITRILFLSTRTDPRQEVELEASREPDSKITQVQISSPLPKPDIESE* |
| Ga0134081_100488713 | 3300014150 | Grasslands Soil | VNGKITRILFLSTRTDPREEAELEASREPDSKITRVEISSPLPKPNIESE* |
| Ga0134078_102114212 | 3300014157 | Grasslands Soil | MFLSTRTDPVQEVKLEAFREPDGKITQVEISSPLPKPDIGSE* |
| Ga0132258_126805651 | 3300015371 | Arabidopsis Rhizosphere | DPRQEVELEASREPESKITQIEISSPLPKPDIESE* |
| Ga0132258_136051063 | 3300015371 | Arabidopsis Rhizosphere | TTRILFLSTRTDPRQEVELEASREPASKVTQVEISSPLPKPEIGSE* |
| Ga0132257_1036490971 | 3300015373 | Arabidopsis Rhizosphere | TRTDPRQEEEMEAKRDAGGKTTEVNISSPLPKPEAASD* |
| Ga0132255_1058009891 | 3300015374 | Arabidopsis Rhizosphere | NPVEKVELEASREPNSKVTQVEISSPLTKPDIASE* |
| Ga0182039_119880562 | 3300016422 | Soil | RILFLSTRTDPRQGVELEASREPNSKITQVQISSPLPKPDIGSE |
| Ga0134112_102371363 | 3300017656 | Grasslands Soil | LFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPNIESE |
| Ga0184608_104270931 | 3300018028 | Groundwater Sediment | FLSTRTDPRQEVELEASREPDGKITKVEISSPLPKPNIESE |
| Ga0184612_101888031 | 3300018078 | Groundwater Sediment | TQTDPVERVELEASREPNSKVTQVEISSPLPKPKIASE |
| Ga0173481_100556353 | 3300019356 | Soil | FLSTRTDPRQEVELEASREPDGKITQIEISSPLPKPNIESE |
| Ga0137408_13389143 | 3300019789 | Vadose Zone Soil | MNVNADHEILFLSTRTDPRQEVELEASREPDSKVTQIEISSPLPKPEIGSE |
| Ga0193748_10086643 | 3300019865 | Soil | SVNGKTTRILFLSTRTDPRQEVELEASLEPGSKVTQVEISSPLPKPEIGSE |
| Ga0193720_10266852 | 3300019868 | Soil | RILFLSTRTDPRQEVELEASRQPDSKVTQVEISSPLPKPEIGSE |
| Ga0193747_11374472 | 3300019885 | Soil | GKITRILSLSTQTDPVERVELEASREPKSKVTQVEISSPLPKPKIGSE |
| Ga0193728_12530442 | 3300019890 | Soil | TTRILFLSTRTDPRQEVELEASREPDSKVTQVEISSPLPKPEIGSE |
| Ga0193731_10463491 | 3300020001 | Soil | STRTDPRQEVELEASREPDSKITQIEISSPLPKPNIESE |
| Ga0193721_10541382 | 3300020018 | Soil | LFLSTRTDPRQEVELEASREPDGKITQVEISSPLPKPDIESE |
| Ga0193733_10193983 | 3300020022 | Soil | MFLSTRTDPVQKVELAARRAPGEKISRVEISSPLPKPEEAGE |
| Ga0210406_112455022 | 3300021168 | Soil | RTDPRQEVELEASREPDAKITRVEISSPLPKPNIESE |
| Ga0193719_100096626 | 3300021344 | Soil | EPVERVELEASREPDGKITQVEISSPLPKPEIESE |
| Ga0210392_104431791 | 3300021475 | Soil | VNGKITRILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDIGSE |
| Ga0222621_11153171 | 3300021510 | Groundwater Sediment | KVTRILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDIGSE |
| Ga0126371_102254941 | 3300021560 | Tropical Forest Soil | GTRTDPRQEVELEASREPESKITQVEISSPLPKPEIDSE |
| Ga0224452_12872791 | 3300022534 | Groundwater Sediment | STQTDPVERVELEASREPNSKVTQVEISSPLPKPEIGSE |
| Ga0247688_11011071 | 3300024186 | Soil | ILFLSTRTDPRQEVELEASREPDSKVTQVQISSPLPKPEIESE |
| Ga0207707_111773292 | 3300025912 | Corn Rhizosphere | NGKITRILFLSTRTDPRQEVELEASREPDSKITQIQISSPLPKPDIESE |
| Ga0207671_110739532 | 3300025914 | Corn Rhizosphere | ITRLLFLSTRTDPRQEVELEASREPDSKITQVQISSPLPKPDIESE |
| Ga0207693_101878983 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | STRTDPRQEVELEASREPDGKITQVEISSPLPKPNIESE |
| Ga0207687_108256851 | 3300025927 | Miscanthus Rhizosphere | TDPRQEVELEASREPDGKITQIEISSPLPKPNIESE |
| Ga0207702_106332691 | 3300026078 | Corn Rhizosphere | LSTRTDPRQEVELEASREPDSKITQIQISSPLPKPDIESE |
| Ga0209863_102420002 | 3300026281 | Prmafrost Soil | VRNNISSNGNLTTIMFLSTRTDPVQKVEMDARRAPGEKISRVEISSP |
| Ga0209648_100523034 | 3300026551 | Grasslands Soil | MFLSTRTGPLQEVKLEASREPGGKITQIEISFPLPKPDVQGE |
| Ga0209590_102773661 | 3300027882 | Vadose Zone Soil | KLTTIMFLSTRSEPVERVELEASREPDGKITQVEISSPLPKPEIESE |
| Ga0268266_101683052 | 3300028379 | Switchgrass Rhizosphere | DPRQEVKMEAKREAGGKTTEVNISSPLPKPEAASD |
| Ga0268266_110948382 | 3300028379 | Switchgrass Rhizosphere | ILFLSTRTDPRQEVELEASREPDGKITQVEISSPLPKPNIESE |
| Ga0137415_108839461 | 3300028536 | Vadose Zone Soil | GKITRILFLSTRTDPRQEVELEASREPDNKITQVEISSPLAKPNIESE |
| Ga0307305_100105817 | 3300028807 | Soil | NGKITRILFLSTRTDPRQEVELEASREPDGKITKVEISSPLPKPNIESE |
| Ga0307289_104226641 | 3300028875 | Soil | FLSTRTDPRQEVELEASREPDSKTTQIEISSPLPKPDIGSE |
| Ga0307277_102046582 | 3300028881 | Soil | TRILSLSTQTDPVERVELEASRMPNSKVTQVEISSPLPKPKIASE |
| Ga0075386_121136911 | 3300030916 | Soil | LFLSTRTDPRQEVELEASREPASKVTQVEISSPLPKPEIGSE |
| Ga0075382_115391141 | 3300030917 | Soil | FLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDIGNE |
| Ga0170834_1062632372 | 3300031057 | Forest Soil | DPRQEVELEASREPDSKITQVQISSPLPKPDIESE |
| Ga0307469_105752632 | 3300031720 | Hardwood Forest Soil | MNVNGKITRILFLSTRTDPRQEVELEASREPDSKVT |
| Ga0307469_124836711 | 3300031720 | Hardwood Forest Soil | TDPRQEVELEASREPDSKITQVEISSPLPKLNIESE |
| Ga0318510_101886821 | 3300032064 | Soil | RTDPRQEVELEASREPESKITQVKISSPLPKPEIDSE |
| Ga0307471_1020962801 | 3300032180 | Hardwood Forest Soil | DPRQEVELEVSREQDGKITQVEISSPLPKPDIESE |
| Ga0307472_1002449753 | 3300032205 | Hardwood Forest Soil | FLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDIESE |
| Ga0310810_103659953 | 3300033412 | Soil | RILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPEIGSE |
| Ga0310811_101101725 | 3300033475 | Soil | ITRILFLSTRTDPRQEVELEASREPDSKITQVEISSPLPKPDIVSE |
| ⦗Top⦘ |