


| Basic Information | |
|---|---|
| Family ID | F089340 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKESYREGVANHPGPEPCEGSRKAALEALDRGICRLGIEL |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.49 % |
| % of genes near scaffold ends (potentially truncated) | 86.24 % |
| % of genes from short scaffolds (< 2000 bps) | 84.40 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.899 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.761 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.431 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.202 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 6.42 |
| PF08388 | GIIM | 3.67 |
| PF01068 | DNA_ligase_A_M | 1.83 |
| PF08843 | AbiEii | 0.92 |
| PF01979 | Amidohydro_1 | 0.92 |
| PF08281 | Sigma70_r4_2 | 0.92 |
| PF05598 | DUF772 | 0.92 |
| PF02424 | ApbE | 0.92 |
| PF01627 | Hpt | 0.92 |
| PF01656 | CbiA | 0.92 |
| PF01402 | RHH_1 | 0.92 |
| PF13620 | CarboxypepD_reg | 0.92 |
| PF04434 | SWIM | 0.92 |
| PF02371 | Transposase_20 | 0.92 |
| PF08309 | LVIVD | 0.92 |
| PF13360 | PQQ_2 | 0.92 |
| PF00271 | Helicase_C | 0.92 |
| PF09335 | SNARE_assoc | 0.92 |
| PF01566 | Nramp | 0.92 |
| PF00005 | ABC_tran | 0.92 |
| PF00150 | Cellulase | 0.92 |
| PF00248 | Aldo_ket_red | 0.92 |
| PF01765 | RRF | 0.92 |
| PF13175 | AAA_15 | 0.92 |
| PF07196 | Flagellin_IN | 0.92 |
| PF07589 | PEP-CTERM | 0.92 |
| PF08002 | DUF1697 | 0.92 |
| PF00809 | Pterin_bind | 0.92 |
| PF01053 | Cys_Met_Meta_PP | 0.92 |
| PF07676 | PD40 | 0.92 |
| PF00694 | Aconitase_C | 0.92 |
| PF07638 | Sigma70_ECF | 0.92 |
| PF02518 | HATPase_c | 0.92 |
| PF00368 | HMG-CoA_red | 0.92 |
| PF04366 | Ysc84 | 0.92 |
| PF02781 | G6PD_C | 0.92 |
| PF14236 | DUF4338 | 0.92 |
| PF00920 | ILVD_EDD | 0.92 |
| PF08335 | GlnD_UR_UTase | 0.92 |
| PF06439 | 3keto-disac_hyd | 0.92 |
| PF07519 | Tannase | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.83 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.83 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.83 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.92 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.92 |
| COG0233 | Ribosome recycling factor | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.92 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.92 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.92 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.92 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.92 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.92 |
| COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 0.92 |
| COG1257 | Hydroxymethylglutaryl-CoA reductase | Lipid transport and metabolism [I] | 0.92 |
| COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.92 |
| COG1345 | Flagellar capping protein FliD | Cell motility [N] | 0.92 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.92 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.92 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.92 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.92 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.92 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.92 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 0.92 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.92 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.92 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.92 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.92 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.92 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.92 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.92 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.92 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.90 % |
| Unclassified | root | N/A | 21.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918024|NODE_68970_length_1926_cov_8.934580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1976 | Open in IMG/M |
| 2199352024|deeps__Contig_165273 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300000953|JGI11615J12901_11602463 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300001686|C688J18823_10521116 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100197281 | Not Available | 1903 | Open in IMG/M |
| 3300005445|Ga0070708_100082144 | Not Available | 2918 | Open in IMG/M |
| 3300005471|Ga0070698_101367470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300005560|Ga0066670_10445470 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005764|Ga0066903_100598675 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300005764|Ga0066903_101317788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1350 | Open in IMG/M |
| 3300005764|Ga0066903_104842003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300005764|Ga0066903_108070984 | Not Available | 540 | Open in IMG/M |
| 3300005983|Ga0081540_1026475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3309 | Open in IMG/M |
| 3300006173|Ga0070716_100454458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 934 | Open in IMG/M |
| 3300006176|Ga0070765_102100863 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006854|Ga0075425_103006337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus | 515 | Open in IMG/M |
| 3300006893|Ga0073928_10115238 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300009012|Ga0066710_102294206 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009038|Ga0099829_10816177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus | 774 | Open in IMG/M |
| 3300009137|Ga0066709_101877907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300009143|Ga0099792_10199988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300009523|Ga0116221_1435563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 572 | Open in IMG/M |
| 3300009637|Ga0116118_1249345 | Not Available | 545 | Open in IMG/M |
| 3300009792|Ga0126374_10491735 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300010047|Ga0126382_11623861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 600 | Open in IMG/M |
| 3300010048|Ga0126373_12247711 | Not Available | 606 | Open in IMG/M |
| 3300010360|Ga0126372_11558155 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010376|Ga0126381_100389814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1937 | Open in IMG/M |
| 3300010376|Ga0126381_104665613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300011271|Ga0137393_11465080 | Not Available | 572 | Open in IMG/M |
| 3300012202|Ga0137363_11354296 | Not Available | 601 | Open in IMG/M |
| 3300012205|Ga0137362_10407004 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300012206|Ga0137380_10464527 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300012363|Ga0137390_10798393 | Not Available | 902 | Open in IMG/M |
| 3300012929|Ga0137404_10620151 | Not Available | 974 | Open in IMG/M |
| 3300012930|Ga0137407_11513631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 638 | Open in IMG/M |
| 3300013091|Ga0163210_1252851 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300013306|Ga0163162_12909910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 551 | Open in IMG/M |
| 3300014160|Ga0181517_10039198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3003 | Open in IMG/M |
| 3300014492|Ga0182013_10552847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 592 | Open in IMG/M |
| 3300014493|Ga0182016_10740849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 549 | Open in IMG/M |
| 3300014496|Ga0182011_10093919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 2094 | Open in IMG/M |
| 3300014498|Ga0182019_10839430 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300014501|Ga0182024_12915594 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300014502|Ga0182021_12826516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300014502|Ga0182021_13019754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 563 | Open in IMG/M |
| 3300014839|Ga0182027_11806838 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300016371|Ga0182034_11587339 | Not Available | 574 | Open in IMG/M |
| 3300016387|Ga0182040_10806620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300017925|Ga0187856_1128273 | Not Available | 976 | Open in IMG/M |
| 3300018005|Ga0187878_1034135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2447 | Open in IMG/M |
| 3300018006|Ga0187804_10435373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 584 | Open in IMG/M |
| 3300018009|Ga0187884_10307236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 641 | Open in IMG/M |
| 3300018017|Ga0187872_10195072 | Not Available | 938 | Open in IMG/M |
| 3300018034|Ga0187863_10598505 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300018035|Ga0187875_10137898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1370 | Open in IMG/M |
| 3300018422|Ga0190265_12316678 | Not Available | 638 | Open in IMG/M |
| 3300018482|Ga0066669_11246039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300019788|Ga0182028_1121989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1449 | Open in IMG/M |
| 3300021170|Ga0210400_10152783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1860 | Open in IMG/M |
| 3300021560|Ga0126371_10014021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7294 | Open in IMG/M |
| 3300022593|Ga0236338_1133849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 508 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10179901 | Not Available | 1061 | Open in IMG/M |
| 3300024331|Ga0247668_1063281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 748 | Open in IMG/M |
| 3300025915|Ga0207693_10553278 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027854|Ga0209517_10383297 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300027879|Ga0209169_10422818 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10003710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 5361 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10322493 | Not Available | 701 | Open in IMG/M |
| 3300028780|Ga0302225_10485552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 577 | Open in IMG/M |
| 3300029883|Ga0311327_10066035 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
| 3300029911|Ga0311361_10019161 | All Organisms → cellular organisms → Bacteria | 12778 | Open in IMG/M |
| 3300029952|Ga0311346_11473559 | Not Available | 511 | Open in IMG/M |
| 3300029953|Ga0311343_10356965 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300030007|Ga0311338_11737232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300030518|Ga0302275_10506220 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300030618|Ga0311354_11092769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300030943|Ga0311366_11411257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 598 | Open in IMG/M |
| 3300031261|Ga0302140_10533629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus | 900 | Open in IMG/M |
| 3300031344|Ga0265316_10222355 | Not Available | 1393 | Open in IMG/M |
| 3300031524|Ga0302320_10210656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2760 | Open in IMG/M |
| 3300031546|Ga0318538_10412016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 731 | Open in IMG/M |
| 3300031549|Ga0318571_10125437 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031572|Ga0318515_10703343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 535 | Open in IMG/M |
| 3300031711|Ga0265314_10332755 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300031724|Ga0318500_10685036 | Not Available | 522 | Open in IMG/M |
| 3300031754|Ga0307475_10157113 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300031768|Ga0318509_10357494 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031770|Ga0318521_10933902 | Not Available | 531 | Open in IMG/M |
| 3300031832|Ga0318499_10261042 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031912|Ga0306921_10196750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 2362 | Open in IMG/M |
| 3300031912|Ga0306921_10841285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300031942|Ga0310916_11185353 | Not Available | 632 | Open in IMG/M |
| 3300031946|Ga0310910_10349897 | Not Available | 1167 | Open in IMG/M |
| 3300031947|Ga0310909_11647720 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031959|Ga0318530_10449321 | Not Available | 535 | Open in IMG/M |
| 3300032035|Ga0310911_10180512 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300032059|Ga0318533_10073404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2320 | Open in IMG/M |
| 3300032074|Ga0308173_10598296 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300032261|Ga0306920_102819675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 661 | Open in IMG/M |
| 3300032261|Ga0306920_104285805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300032783|Ga0335079_10023253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 7097 | Open in IMG/M |
| 3300032783|Ga0335079_10024333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6938 | Open in IMG/M |
| 3300032783|Ga0335079_10608314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300032897|Ga0335071_10661547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300032955|Ga0335076_10155579 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
| 3300033402|Ga0326728_10336395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1343 | Open in IMG/M |
| 3300033402|Ga0326728_10896614 | Not Available | 629 | Open in IMG/M |
| 3300033405|Ga0326727_10287846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1637 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.42% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 6.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.50% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.75% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013091 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022593 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2 | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B_all_v_01128310 | 2140918024 | Soil | MKESYREGVANRPGPEPCECSRKTAPEALDRGICRLGIELR |
| deeps_03048380 | 2199352024 | Soil | MKESYRKGVANHPDPEPCEGGGNDALEALERGICRLGNPK |
| JGI11615J12901_116024631 | 3300000953 | Soil | MKESYRKGVANHPDPEPCEGGGNNALEALARGICRLGIPK* |
| C688J18823_105211161 | 3300001686 | Soil | MKESYRKDVANHPGPEPCEGGREAALEALDRGICRLGH* |
| JGIcombinedJ26739_1001972812 | 3300002245 | Forest Soil | SYRKGVANHPDLDPCEGGGNDALEALGRGTCRQGIPKL* |
| Ga0070708_1000821442 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKETYRKGVANHPDLDPCEGGGNDALEALGRGTCRQGIPKW* |
| Ga0070698_1013674702 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GVANHPGLESCGGGRETALEALDRGICRLGIELRKRVSIRG* |
| Ga0066670_104454702 | 3300005560 | Soil | MKESYRKGVANHPDPKPCGGSSNAAPEALDRGRCRLGIPEVDEL* |
| Ga0066903_1005986756 | 3300005764 | Tropical Forest Soil | MRESYREGLASRSGPEPCGGGRKAALEALDRGICRQGIELRKDLF |
| Ga0066903_1013177882 | 3300005764 | Tropical Forest Soil | MKESHRKGVANHPDPDPCESDGNSELEALGRGICRLGIPK* |
| Ga0066903_1048420031 | 3300005764 | Tropical Forest Soil | MKKSHREGVANHPGPEPCEGSRKAVLEALDRGICRLGIELRNQ |
| Ga0066903_1080709841 | 3300005764 | Tropical Forest Soil | MQELYRKDLANHPGPEPCEGGRKVALEALDRGICRLSIELRYIQEKKGG* |
| Ga0081540_10264752 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKESDREGVANHSGPEPCEGTREGVFEALDRGIGRLGIELRNPAIPGAEGVSKSRRPQRAAR* |
| Ga0070716_1004544581 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | YRKGVANHPDLDPCEGGGNDALEALGRGTCRQGIPKW* |
| Ga0070765_1021008631 | 3300006176 | Soil | MKESYREGVASHSGPEPCEGGREAVLEALDRGICRLGIELR |
| Ga0075425_1030063372 | 3300006854 | Populus Rhizosphere | MKESYREGVASHSGPEPCEGGGNVALEALDRGICRLGIELRNQ |
| Ga0073928_101152382 | 3300006893 | Iron-Sulfur Acid Spring | MKESYRKGVANHPDLDPCEGVGNDALEALGRGTCRQGIPKL* |
| Ga0066710_1022942061 | 3300009012 | Grasslands Soil | MQESYREGVANHPGPEPCEGSRKAALEALDRGICRLGIELRKSR |
| Ga0099829_108161771 | 3300009038 | Vadose Zone Soil | MKESYREGVANHPGPEPCEGGGNVALEALDRGICR |
| Ga0066709_1018779071 | 3300009137 | Grasslands Soil | MKESYREGVANHSGPEPCEGGGNVALEALDRGICRLGIELRNQ |
| Ga0099792_101999881 | 3300009143 | Vadose Zone Soil | MKESYREGVANHSGPEPCEGGGNVALEALDRGICRLGI |
| Ga0116221_14355632 | 3300009523 | Peatlands Soil | MKESYRNGVANHPDPELCEGGGNGALEALARGTCRLVIPEVDELRNSQ |
| Ga0116118_12493451 | 3300009637 | Peatland | MKESYREGLASHPGPQPREGGREVALEALERGIRRQGIELRNQLIP |
| Ga0126374_104917353 | 3300009792 | Tropical Forest Soil | MKESYRKGVANHPGPEPCEGSHEAALEALDRGILLRTA |
| Ga0126382_116238612 | 3300010047 | Tropical Forest Soil | MRELYRKDLANHPGPEPCEGGRKVALEALDRGICRLSIEL |
| Ga0126373_122477111 | 3300010048 | Tropical Forest Soil | GIANQPGPEPCEGGREAALEALDRGICGRGIDLRNL* |
| Ga0126372_115581552 | 3300010360 | Tropical Forest Soil | MKESHRKGVANHPGPEPCEGSREAALEALDRGIYRLG |
| Ga0126381_1003898141 | 3300010376 | Tropical Forest Soil | MRESYREGVTNNPGTELWEGGRKTALEALDMGICRLGIELRYIQEKKGG* |
| Ga0126381_1046656131 | 3300010376 | Tropical Forest Soil | MKESYRKGVANHPGPEPCEGSREAALEALDRGIYRL |
| Ga0137393_114650802 | 3300011271 | Vadose Zone Soil | MRESYREGIANHPGPEPCEGGGNVALEALDRGICRLGIELRNLAVRGADGVRQQGRQ |
| Ga0137363_113542962 | 3300012202 | Vadose Zone Soil | MKKSYREGVASHSGPEPCEGGGNVALEALDRGICRLGIELRNQ |
| Ga0137362_104070041 | 3300012205 | Vadose Zone Soil | MKESYREGEANHSGPEPCEGGGNVALEALDRGICRLGIELRNQGFREADGV |
| Ga0137380_104645271 | 3300012206 | Vadose Zone Soil | MEESYREGVASHSGPEPCEGGGNVALEALDRGICRLGIELRNQGFREADGV |
| Ga0137390_107983931 | 3300012363 | Vadose Zone Soil | MKELYRKDLANHPGPEPCEGGRKTALEALDRGICRLAI |
| Ga0137404_106201511 | 3300012929 | Vadose Zone Soil | MQESYREGVANHSGPEPCEGSSNAVLEALDRGICRLG |
| Ga0137407_115136311 | 3300012930 | Vadose Zone Soil | MKESCRKGVANRPDLDPCEGVGNGALEALGRGTCRLGIPKL* |
| Ga0163210_12528511 | 3300013091 | Freshwater | MKESHRKGVANHPGPEPCEGSREAALEALDRGICRL |
| Ga0163162_129099102 | 3300013306 | Switchgrass Rhizosphere | GVANHPDLDPCEGIAKTKDALEALGRGTCRLGTPKL* |
| Ga0181517_100391981 | 3300014160 | Bog | MKESYREGVASHPGPQPCEGGREAALEAWERGIRRQDIEL |
| Ga0182013_105528471 | 3300014492 | Bog | MKESYRKGVANHPDPEPCEGGGNDALEALDRGICRLGIPEDDP |
| Ga0182016_107408492 | 3300014493 | Bog | MKESYREGIANHPGPEPCEGSREAALEALDRGICRLGIELRKSRFREA |
| Ga0182011_100939193 | 3300014496 | Fen | MQESYREGIASRPGPAEPCEGSREAALEALDRGICRLGIELRNRVVQGADGV |
| Ga0182019_108394301 | 3300014498 | Fen | MQESYREGVANRPGPEPCEGGCKAALEALDRGICRLG |
| Ga0182024_129155942 | 3300014501 | Permafrost | MKESYREGIANHPGPEPCEGSRNAALEALDRGICRLGIELR |
| Ga0182021_128265161 | 3300014502 | Fen | MKESYREGVANHPGPEPCEGSRKAALEALDRGICRLDIELRNQLVQGADGVRVQGRQQRAAR |
| Ga0182021_130197541 | 3300014502 | Fen | MKESYREGIANRPGPEPCEGSRKAALEALDRGICRLGIELRKQVVQGAD |
| Ga0182027_118068382 | 3300014839 | Fen | MKESYREGVANHPGPEPCEGSRKAALEALDRGICRL |
| Ga0182034_115873391 | 3300016371 | Soil | MEESYREGVANHPGPEPCEGGRKAALEALDRGICRLGI |
| Ga0182040_108066201 | 3300016387 | Soil | MKESYRKDLANHPGPEPCEGGREVALEALNRGICR |
| Ga0187856_11282733 | 3300017925 | Peatland | MKESYREGIASHPGPQPCEGGREVALEALERGIRRQGIEL |
| Ga0187878_10341351 | 3300018005 | Peatland | MKESYREGIASHPGPLPCEGGREVALEALERGIRR |
| Ga0187804_104353731 | 3300018006 | Freshwater Sediment | MKESYRKGVANYPGPEPCEGSREAALEALDRGICR |
| Ga0187884_103072362 | 3300018009 | Peatland | MRESYREGVASHPGPQQCEGSREAALEALERGIRRQEV |
| Ga0187872_101950721 | 3300018017 | Peatland | MKESYREGIASHPGPQPCEGGREVALEALERGIRRQ |
| Ga0187863_105985051 | 3300018034 | Peatland | MKESYRQGIANHPGPEPCEGGRKAALEALDRGICRLGIELRERPNQGSR |
| Ga0187875_101378982 | 3300018035 | Peatland | MKESYRKGVAIHSDPEPCEGGREAALEALDRGICRLGIPEVD |
| Ga0190265_123166781 | 3300018422 | Soil | MRESYRKGVANHPGPEPCEGSREVALEALDRGIYRL |
| Ga0066669_112460391 | 3300018482 | Grasslands Soil | MKESYREGVASHSGPEPCEGGGNVALEALDRGICRLGIELRNQG |
| Ga0182028_11219893 | 3300019788 | Fen | MKESYREGVANRPGPEPCESSRKTAPEALDRGICRLGIE |
| Ga0210400_101527831 | 3300021170 | Soil | MKESSREGVANHPGPEPCEGGREAALEALDRGIGRLGTELRNRVLRGA |
| Ga0126371_100140211 | 3300021560 | Tropical Forest Soil | MKESYREGVTNHPGPEPCEGGRKTALEALDIHDKDLS |
| Ga0236338_11338492 | 3300022593 | Freshwater | MKESYREGVANHPGPEPCEGSRKAALEALDRGICRLGIEL |
| (restricted) Ga0233425_101799011 | 3300024054 | Freshwater | MKESYREGVAGHPGPEPCEGGHKAALEALDRGICRRGMELRNRAGRGAGGVR |
| Ga0247668_10632812 | 3300024331 | Soil | MKESYREGKANRPGPEPCEGSRKAALEALDRGICRLGIELRKRPIREADGVRQPGRPRRVAR |
| Ga0207693_105532781 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YRKGVANHPDLDPCEGGGNDALEALGRGTCRQGIPKW |
| Ga0209517_103832973 | 3300027854 | Peatlands Soil | MQESYREGAASHPGPQPCEGGREAALEAWERGICRQDIELRNPALP |
| Ga0209169_104228181 | 3300027879 | Soil | MKESYREGIANHSGPEPCEGGGNAALEALDRGICRLGIE |
| (restricted) Ga0233417_100037102 | 3300028043 | Sediment | MKESHRKGVANHPDPEPCEGGRKVTLEALDRGIGRLGIPKL |
| (restricted) Ga0233417_103224933 | 3300028043 | Sediment | MEESYREGPANHSGPEPCEGSRKVALEALDRGICRLG |
| Ga0302225_104855522 | 3300028780 | Palsa | RKGVANHPDPEPCEGGREAALEALDRGIGRLGIPK |
| Ga0311327_100660355 | 3300029883 | Bog | MKESYREGVANHSDPEPCECERKVALEALDRGICRLGIELRNSVVQGADGVRQSEGKTG |
| Ga0311361_100191611 | 3300029911 | Bog | MKESYREGVANHSDPEPCECDRKVALEALDRGICRLGIELRNSVVQGADGVRQSEGKTGRAIT |
| Ga0311346_114735591 | 3300029952 | Bog | NTEKGIANRSDPEPCEGREAALEALDGGICRLGYP |
| Ga0311343_103569652 | 3300029953 | Bog | MKESYREGVANHSDPEPCECERKVALEALDRGICRLGIELRNSVVQGADGV |
| Ga0311338_117372322 | 3300030007 | Palsa | MKESYREGIANHPGPEPCEGGGNVVLEALDRGNRRLGIE |
| Ga0302275_105062202 | 3300030518 | Bog | MKESYREGVANHSDPEPCECERKVALEALDRGICRLGIELRNSVVQGADGVR |
| Ga0311354_110927691 | 3300030618 | Palsa | MKESHRKGVANHSDLDPCEGVGNGALEALGRGTYRLGIPEVD |
| Ga0311366_114112571 | 3300030943 | Fen | SYRKGVANHPDPEPCQCDRKVALEALDRGICRLGIPKL |
| Ga0302140_105336291 | 3300031261 | Bog | MKESYREGVANHSDPEPCECERKVALEALDRGICRLGIELRNSVVQGADGVRQSEGKTGRAIT |
| Ga0265316_102223552 | 3300031344 | Rhizosphere | VKKSYREGIASHPGPEPCEGGGNVALEALDRAKRVRP |
| Ga0302320_102106561 | 3300031524 | Bog | MKESYREGVANHSDPEPCECERKVALEALDRGICRLGIELRNNVVQG |
| Ga0318538_104120162 | 3300031546 | Soil | MKESYRKDLASHPGPEPCEGGRKDALEALDRGICRLGIELRYIQEKKGG |
| Ga0318571_101254373 | 3300031549 | Soil | MKESYRKGVANHPGPEPCEGSREAALEALDRGIYRLGRELRK |
| Ga0318515_107033432 | 3300031572 | Soil | MKESYREGVANHPGPEPCEGSRKAALEALDRGICRQGIELRYIQEKKGG |
| Ga0265314_103327551 | 3300031711 | Rhizosphere | KKSYREGIASHPGPEPCEGGGNVALEALDRAKRVRP |
| Ga0318500_106850361 | 3300031724 | Soil | MKESYRKDLANHPGPEPCEGGRKVALEALDRGICR |
| Ga0307475_101571131 | 3300031754 | Hardwood Forest Soil | MRESYRKGIANHPGPEPCEGGREAALEALDRGICGLGIELR |
| Ga0318509_103574942 | 3300031768 | Soil | MKESYRKGVANHPGPEPCEGSREAALEALDRGIHKLGM |
| Ga0318521_109339021 | 3300031770 | Soil | MQESYREGVANHPDPEPCEGGRKAALEALDRGICR |
| Ga0318499_102610422 | 3300031832 | Soil | MKESYRKGVANHPGPEPCEGGREAALEALDRGIHRL |
| Ga0306921_101967502 | 3300031912 | Soil | MRESYREGVANHPGPEPCEGSRKAALEALDRGICRQGIELRYIQEKKGG |
| Ga0306921_108412852 | 3300031912 | Soil | MKESYRKDLANHPGPEPCEGGREVALEALNRGICRLGIEL |
| Ga0310916_111853531 | 3300031942 | Soil | MRESYREGLASHSGPEPCGGGRKAALEALDRGICRQGIELRYIQEK |
| Ga0310910_103498971 | 3300031946 | Soil | MKESYRKDLASHPGPEPCEGGRKDALEALDRGICRLGIELRN |
| Ga0310909_116477202 | 3300031947 | Soil | MQESYREGIANHSGPEPCEGDRKVALEALDRGICRLGYGAS |
| Ga0318530_104493211 | 3300031959 | Soil | MKESYRKDLANHPGPKPCEGGRKAALEALDRGICRLGI |
| Ga0310911_101805123 | 3300032035 | Soil | MKESYRKGVANHPGPEPCEGSREAALEALDRGIYRLGMEL |
| Ga0318533_100734041 | 3300032059 | Soil | ESYREGVANHPGPEPCEGSRKAALEALDRGICRQGIELRYIQEKKGG |
| Ga0308173_105982961 | 3300032074 | Soil | MRESYREGVANHPGPEPCGGGREAVTEALDRGICRLGIELRKNPDRGADGV |
| Ga0306920_1028196751 | 3300032261 | Soil | MRESYREGVANHPGPEPCEGSRKAALEALDRGICRQGIELRYIQEK |
| Ga0306920_1042858052 | 3300032261 | Soil | MKESYRKGVANHPGPEPCEGGREAALEALDRGIHRLGMELRK |
| Ga0335079_100232531 | 3300032783 | Soil | MKESYREGVANHPGPEPCEGSRKAVLEALDRGICRLG |
| Ga0335079_100243336 | 3300032783 | Soil | MQESYREGVANHPGPEPCEGGREAALEALDRGICGQGTGLRNLALQGADRDGLSGRQQRVTR |
| Ga0335079_106083143 | 3300032783 | Soil | EGVANHSGPEPCEGGGNDALEALDRGICRLGIELRNG |
| Ga0335071_106615472 | 3300032897 | Soil | MKESYREGVASHPGPQPCEGGRKVALEALERGIRRQGIELR |
| Ga0335076_101555792 | 3300032955 | Soil | MRESYRKGVTNHPGPEPCEGGREAALEALDRGIYRLGIEL |
| Ga0326728_103363951 | 3300033402 | Peat Soil | MKESYREGVASRPGPQPCEGGREAALEALERGIRRQGI |
| Ga0326728_108966141 | 3300033402 | Peat Soil | MKESYREGVANRPGPEPCECSRKTAPEALDRGICRLGIELRNQTFQG |
| Ga0326727_102878461 | 3300033405 | Peat Soil | MKESYREGVANYPGPEPCEGSRKAALEALDRGICRLGI |
| ⦗Top⦘ |