


| Basic Information | |
|---|---|
| Family ID | F089324 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PASAPRKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.08 % |
| % of genes from short scaffolds (< 2000 bps) | 89.91 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (6.422 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.110 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (30.275 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.90% β-sheet: 0.00% Coil/Unstructured: 83.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 60.55 |
| PF09084 | NMT1 | 7.34 |
| PF16277 | DUF4926 | 4.59 |
| PF00848 | Ring_hydroxyl_A | 4.59 |
| PF00355 | Rieske | 4.59 |
| PF04255 | DUF433 | 2.75 |
| PF00582 | Usp | 1.83 |
| PF02954 | HTH_8 | 1.83 |
| PF15919 | HicB_lk_antitox | 1.83 |
| PF08241 | Methyltransf_11 | 0.92 |
| PF04607 | RelA_SpoT | 0.92 |
| PF03721 | UDPG_MGDP_dh_N | 0.92 |
| PF00211 | Guanylate_cyc | 0.92 |
| PF01118 | Semialdhyde_dh | 0.92 |
| PF12760 | Zn_Tnp_IS1595 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 9.17 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.34 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.34 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 2.75 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.92 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.92 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.92 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.08 % |
| Unclassified | root | N/A | 0.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2267793 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300000550|F24TB_14059833 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1043379 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300000787|JGI11643J11755_11340217 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10113871 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300000953|JGI11615J12901_10180084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 875 | Open in IMG/M |
| 3300000955|JGI1027J12803_102059936 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300003324|soilH2_10011036 | All Organisms → cellular organisms → Bacteria | 15446 | Open in IMG/M |
| 3300003993|Ga0055468_10302001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300004463|Ga0063356_101795555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300004463|Ga0063356_102457545 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300004633|Ga0066395_10860535 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005169|Ga0066810_10123246 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005177|Ga0066690_10447503 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005289|Ga0065704_10025015 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300005289|Ga0065704_10199503 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300005332|Ga0066388_102841814 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005336|Ga0070680_101240412 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005340|Ga0070689_100547739 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300005436|Ga0070713_101391015 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005614|Ga0068856_102024226 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005764|Ga0066903_104757339 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005764|Ga0066903_107213955 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005829|Ga0074479_10109207 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300005830|Ga0074473_11241106 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300006032|Ga0066696_10559734 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300006049|Ga0075417_10745898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300006173|Ga0070716_101064244 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300006845|Ga0075421_101543293 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006854|Ga0075425_101399052 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006865|Ga0073934_10081814 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
| 3300006871|Ga0075434_101860464 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006881|Ga0068865_101105241 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300006894|Ga0079215_10270034 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300009012|Ga0066710_101494176 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300009081|Ga0105098_10053337 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300009091|Ga0102851_12217783 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009094|Ga0111539_11817175 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300009137|Ga0066709_104484723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300009147|Ga0114129_11690742 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300009156|Ga0111538_11321628 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300009167|Ga0113563_10834906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Caldilineae → Caldilineales → Caldilineaceae → Caldilinea → Caldilinea aerophila | 1047 | Open in IMG/M |
| 3300009551|Ga0105238_11894617 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300009609|Ga0105347_1257667 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009814|Ga0105082_1046455 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300009837|Ga0105058_1001347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3924 | Open in IMG/M |
| 3300010046|Ga0126384_11240567 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010048|Ga0126373_12737852 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010304|Ga0134088_10041041 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300010323|Ga0134086_10037817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1610 | Open in IMG/M |
| 3300010358|Ga0126370_10161888 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300010359|Ga0126376_12836642 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010362|Ga0126377_11819162 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300010375|Ga0105239_10233754 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300011436|Ga0137458_1282605 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012096|Ga0137389_10532935 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012204|Ga0137374_10940865 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012231|Ga0137465_1143123 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012474|Ga0157356_1024816 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012512|Ga0157327_1025472 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012685|Ga0137397_10282105 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300012685|Ga0137397_10995341 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012929|Ga0137404_10571239 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300012929|Ga0137404_10849433 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300012948|Ga0126375_10482129 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300012948|Ga0126375_10910328 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012989|Ga0164305_11447664 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300014259|Ga0075311_1080420 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300014270|Ga0075325_1078700 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300014296|Ga0075344_1011220 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300014969|Ga0157376_12439334 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300016357|Ga0182032_10675186 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300018000|Ga0184604_10358081 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018052|Ga0184638_1121787 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300018075|Ga0184632_10028228 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
| 3300018079|Ga0184627_10036355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2508 | Open in IMG/M |
| 3300018079|Ga0184627_10419012 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300018081|Ga0184625_10073187 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300018084|Ga0184629_10105763 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300019879|Ga0193723_1088539 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300021073|Ga0210378_10039021 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300021081|Ga0210379_10021640 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300022195|Ga0222625_1273851 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300022563|Ga0212128_10809372 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300022694|Ga0222623_10050055 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300025160|Ga0209109_10147522 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300025310|Ga0209172_10506300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300025318|Ga0209519_10583720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300025319|Ga0209520_10257586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
| 3300025901|Ga0207688_10790840 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025921|Ga0207652_11082926 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300025922|Ga0207646_10493915 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300026051|Ga0208911_1016914 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300026088|Ga0207641_12305021 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300026095|Ga0207676_10900599 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300026524|Ga0209690_1002078 | All Organisms → cellular organisms → Bacteria | 11466 | Open in IMG/M |
| 3300027654|Ga0209799_1006359 | All Organisms → cellular organisms → Bacteria | 2464 | Open in IMG/M |
| 3300027775|Ga0209177_10397255 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300028807|Ga0307305_10084102 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300031573|Ga0310915_10626408 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031716|Ga0310813_10997556 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300031720|Ga0307469_11290014 | Not Available | 693 | Open in IMG/M |
| 3300031858|Ga0310892_10412493 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300031911|Ga0307412_11355204 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300032059|Ga0318533_11202011 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032075|Ga0310890_11784693 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300033434|Ga0316613_10966626 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300033475|Ga0310811_10141003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3050 | Open in IMG/M |
| 3300034164|Ga0364940_0217018 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.67% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.83% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.83% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.92% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026051 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_22677933 | 3300000033 | Soil | RRVDIGRDGPNHKKNLEACKLCKHALSDPDGVLLDLTD* |
| F24TB_140598331 | 3300000550 | Soil | AAPASAHRKIAIGREGETRQKNLEGCKLCKHALSDPDGVLLDLTD* |
| AF_2010_repII_A01DRAFT_10433793 | 3300000580 | Forest Soil | ASAARKIAIGREGEKRQKNLEACKLCRHALADPDGVLLDLTD* |
| JGI11643J11755_113402171 | 3300000787 | Soil | IGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD* |
| AF_2010_repII_A001DRAFT_101138711 | 3300000793 | Forest Soil | LAATAPASAARKIAIGREGEKRQKNLEACKLCRHALADPDGVLLDLTD* |
| JGI11615J12901_101800843 | 3300000953 | Soil | RVDIGRDGPNHKKNLEACKLCKHALADPDGVLLDLTD* |
| JGI1027J12803_1020599361 | 3300000955 | Soil | TIGREGEKRQKNLESCKLCRHALADPDGVLLDLTD* |
| soilH2_100110369 | 3300003324 | Sugarcane Root And Bulk Soil | SSPRKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0055468_103020012 | 3300003993 | Natural And Restored Wetlands | TAAPASAPRKIAIGRDGETRQKNLEGCKLCRQSLSDPDGVLLDLTD* |
| Ga0063356_1017955553 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GAGHPESAARRVDIGRDGPNHLKNLEACKLCKHALADPDGVLLDLTD* |
| Ga0063356_1024575451 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AEPKAGARKIAIGRDGEVREKNLQGCKLCKHAISDPDGVLLDLTD* |
| Ga0066395_108605351 | 3300004633 | Tropical Forest Soil | TLAATTPASAARKIAIGREGEKRQKNLEACKLCRHALADPDGVLLDLTD* |
| Ga0066810_101232462 | 3300005169 | Soil | LDALGAAHPESAARRVDIGRDGPNHMKNLEACKLCKHALSDPDGVLLDLTD* |
| Ga0066690_104475031 | 3300005177 | Soil | SGARKIATGRDGERRQKNLENCKLCKQSLSDPDGVLLDLTD* |
| Ga0065704_100250153 | 3300005289 | Switchgrass Rhizosphere | AKKDVENLPNTVPGSAARKIAIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0065704_101995031 | 3300005289 | Switchgrass Rhizosphere | AAPASAARKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0066388_1028418143 | 3300005332 | Tropical Forest Soil | NTVPGSAARKIAIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0070680_1012404122 | 3300005336 | Corn Rhizosphere | ALSASNPESKPRKVAIGREGEKHKANLEGCRLCKQSLSDPDGVLLDLTD* |
| Ga0070689_1005477393 | 3300005340 | Switchgrass Rhizosphere | SPASAPRKIAIGREGEKRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0070713_1013910151 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAAPASAPRKIAIGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD* |
| Ga0068856_1020242261 | 3300005614 | Corn Rhizosphere | LEALAAAAPASAARKIAIGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD* |
| Ga0066903_1047573393 | 3300005764 | Tropical Forest Soil | RKVGVGREGERHRKNLEGCKLCKQGLSDPDGVLLDLTD* |
| Ga0066903_1072139551 | 3300005764 | Tropical Forest Soil | IAIGRDGETRQKNLEGCRLCKYSLADPDGVLLDLTD* |
| Ga0074479_101092073 | 3300005829 | Sediment (Intertidal) | ESAARRVDIGRDGPNHMKNLEDCKLCKHALSDPDGVLLDLTD* |
| Ga0074473_112411061 | 3300005830 | Sediment (Intertidal) | PASAPRKIAIGREGEVRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0066696_105597341 | 3300006032 | Soil | RKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0075417_107458982 | 3300006049 | Populus Rhizosphere | LETLAAAEPKSGARKIAIGRDGEVRQKNLEGCKLCKHAISDPDGVLLDLTD* |
| Ga0070716_1010642441 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EQTKKDLDALAAAAPGSAARKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0075421_1015432931 | 3300006845 | Populus Rhizosphere | IAIGREGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0075425_1013990521 | 3300006854 | Populus Rhizosphere | ATAPDSAPRKIAIGRDGETRQKNLEGCRLCKYSLADPDGVLLDLTD* |
| Ga0073934_100818144 | 3300006865 | Hot Spring Sediment | GSAHRKIAIGRDGETRQKNLEGCKFCKLALSDPDGVLLDLTD* |
| Ga0075434_1018604642 | 3300006871 | Populus Rhizosphere | LQQTKKDLDDLAATAPSSAHRKIAIGREGETRQKNLEGCKLCKHALSDPDGILLDLTD* |
| Ga0068865_1011052413 | 3300006881 | Miscanthus Rhizosphere | IAIGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD* |
| Ga0079215_102700343 | 3300006894 | Agricultural Soil | AIGRDGEVREKNLEGCKLCKHSLADPDGVLLDLTD* |
| Ga0066710_1014941761 | 3300009012 | Grasslands Soil | NLEAAKKDIENLSNSAPGSGARKIAIGREGETRQKNLEACKLCRHALADPDGVLLDLTD |
| Ga0105098_100533371 | 3300009081 | Freshwater Sediment | KDIENLSSTVPGSAARKIAIGRDGETRQKNLEACRLCRHPLADPDGVLLDLTD* |
| Ga0102851_122177831 | 3300009091 | Freshwater Wetlands | DLDALRAAHPESAARRVDIGRDGPNHMKNLEACKLCKHALSDPDGVLLDLTD* |
| Ga0111539_118171753 | 3300009094 | Populus Rhizosphere | PASAPRKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0066709_1044847231 | 3300009137 | Grasslands Soil | LAGSAPTSGARKIAIGRDGERRQKNLEDCKLCKQSLSDPDGVLLDLTD* |
| Ga0114129_116907422 | 3300009147 | Populus Rhizosphere | ETLAADEPKAGARKIAIGRDGEVREKNLEGCKLCKHAISDPDGVLLDLTD* |
| Ga0111538_113216283 | 3300009156 | Populus Rhizosphere | RKIAIGREGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0113563_108349061 | 3300009167 | Freshwater Wetlands | AARRVDIGRDGPNHQKNLEGCKLCKHALSDPDGVLLDLTD* |
| Ga0105238_118946173 | 3300009551 | Corn Rhizosphere | RKIAIGRDGETRQKNLAGCGLCKHPLADPDGVLLDLTD* |
| Ga0105347_12576671 | 3300009609 | Soil | VGREGERHRKNLESCKLCKQGLSDPDGVLLDLTD* |
| Ga0105082_10464552 | 3300009814 | Groundwater Sand | SSPASASRKIAIGREGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0105058_10013471 | 3300009837 | Groundwater Sand | NLEAAKKDIENLPNTVPGSAARTIAIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0126384_112405671 | 3300010046 | Tropical Forest Soil | IGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0126373_127378522 | 3300010048 | Tropical Forest Soil | PASAPRKIAIGRDGETRQKNLEGCRLCKYSLADPDGVLLDLTD* |
| Ga0134088_100410411 | 3300010304 | Grasslands Soil | AATAPASAHRKIAVGREGETRQKNFEGCKLCKHAISDPDGVLLDLTD* |
| Ga0134086_100378171 | 3300010323 | Grasslands Soil | QTKKDLDVLAGSAPTSGARKIAIGRDGERRQKNLEDCKLCKQSLSDPDGVLLDLTD* |
| Ga0126370_101618881 | 3300010358 | Tropical Forest Soil | AAKKDVENLPNTAPGSTARKITIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0126376_128366422 | 3300010359 | Tropical Forest Soil | PNTAPGSTARKITIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0126377_118191621 | 3300010362 | Tropical Forest Soil | ARKITIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0105239_102337541 | 3300010375 | Corn Rhizosphere | RKIAIGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD* |
| Ga0137458_12826052 | 3300011436 | Soil | RVDIGRDGPNHRKNLEACKLCKHALSDPDGVLLDLTD* |
| Ga0137389_105329351 | 3300012096 | Vadose Zone Soil | IENLTHTIPVSAARKIAIGREGEKRQKNLEACKLCRHALADPDGVLLDLTD* |
| Ga0137374_109408652 | 3300012204 | Vadose Zone Soil | PNTVPGSAARKIAIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0137465_11431231 | 3300012231 | Soil | SSPASAPRKIAIGREGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0157356_10248162 | 3300012474 | Unplanted Soil | PASAPRKIAIGREGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0157327_10254721 | 3300012512 | Arabidopsis Rhizosphere | APRKIAIGREGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0137397_102821053 | 3300012685 | Vadose Zone Soil | AIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0137397_109953411 | 3300012685 | Vadose Zone Soil | AATPGSAARKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD* |
| Ga0137404_105712391 | 3300012929 | Vadose Zone Soil | KDIENLPNTAPGSTSRKISIGRDGETRQKNLEGCKLCRYPLADPDGVLLDLTD* |
| Ga0137404_108494331 | 3300012929 | Vadose Zone Soil | AKKDIENLPNTAPGSTSRKISIGRDGETRQKNLEGCKLCRYPLADPDGVLLDLTD* |
| Ga0126375_104821291 | 3300012948 | Tropical Forest Soil | RKIAIGREGEKRQKNLEACKLCRHALADPDGVLLDLTD* |
| Ga0126375_109103281 | 3300012948 | Tropical Forest Soil | RKITIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0164305_114476641 | 3300012989 | Soil | TVPGSAARKIAIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD* |
| Ga0075311_10804202 | 3300014259 | Natural And Restored Wetlands | VENLSQTAPGSAARKIAIGRDGETRQKNLEACRLCKHPLADPDGVLLDLAD* |
| Ga0075325_10787003 | 3300014270 | Natural And Restored Wetlands | RRVDVGRDGPKHKENLEGCKLCKQGLADPDGVLLDLTD* |
| Ga0075344_10112201 | 3300014296 | Natural And Restored Wetlands | LATEFPASAPRNVDVGREGERHRKNLESCKLCKQGLSDPDGVLLDLTD* |
| Ga0157376_124393341 | 3300014969 | Miscanthus Rhizosphere | PASAPRKIAIGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD* |
| Ga0182032_106751861 | 3300016357 | Soil | APRKIAIGRDGETRQKNLEGCRLCKYSLADPDGVLLDLTD |
| Ga0184604_103580811 | 3300018000 | Groundwater Sediment | APRKIAIGREGETRQKNLEGCKLCKQSLADPDGVLLDLTD |
| Ga0184638_11217875 | 3300018052 | Groundwater Sediment | PAAAARKIAIGRDGPQRQKNLEGCKLCKHPLADPDGVLLDLTD |
| Ga0184632_100282281 | 3300018075 | Groundwater Sediment | QTKKDLEALAASTPASSARKIAIGREGETRQKNLEGCKLCKYPLADPDGVLLDLTD |
| Ga0184627_100363554 | 3300018079 | Groundwater Sediment | AKKDIENLPNTAPGSSARTIAIGRDGETRQKNLEGCKLCKYSLADPDGVLLDLTD |
| Ga0184627_104190121 | 3300018079 | Groundwater Sediment | RKIAVGREGEMRQKNFEGCKLCKHAISDPDGVLLDLTD |
| Ga0184625_100731871 | 3300018081 | Groundwater Sediment | LEALAASTPASSARKIAIGREGETRQKNLEGCKLCKYPLADPDGVLLDLTD |
| Ga0184629_101057631 | 3300018084 | Groundwater Sediment | KDLEALAATTPASSARKIAIGREGEKRQKNLEGCKLCKYPLADPDGVLLDLTD |
| Ga0193723_10885391 | 3300019879 | Soil | LAAAAPGSAARKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD |
| Ga0210378_100390213 | 3300021073 | Groundwater Sediment | PASAHRKIAVGREGETRQKNFEGCKLCKHAISDPDGVLLDLTD |
| Ga0210379_100216401 | 3300021081 | Groundwater Sediment | NTVPGSAARKIAIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD |
| Ga0222625_12738513 | 3300022195 | Groundwater Sediment | LDTLAATAPASAHRKIAVGREGETRQKNFEGCKLCKHAISDPDGVLLDLTD |
| Ga0212128_108093722 | 3300022563 | Thermal Springs | PRKIAIGRDGETRRKNLEGCKLCRQSLSDPDGVLLDLTD |
| Ga0222623_100500553 | 3300022694 | Groundwater Sediment | ASAHRKIAVGREGETRQKNFEGCKLCKHAISDPDGVLLDLTD |
| Ga0209109_101475221 | 3300025160 | Soil | GSAARNIAIGRDGETRQKNLQGCKLCKHALADPDGVLLDLTD |
| Ga0209172_105063001 | 3300025310 | Hot Spring Sediment | RKIAIGRDGETRQKNLEGCKFCKLALSDPDGVLLDLTD |
| Ga0209519_105837202 | 3300025318 | Soil | PASAPRKIAIGRDGETRQKNLEGCKLCRQSLSDPDGVLLDLTD |
| Ga0209520_102575862 | 3300025319 | Soil | RNIAIGRDGETRQKNLQGCKLCKHALADPDGVLLDLTD |
| Ga0207688_107908401 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AARKITIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD |
| Ga0207652_110829263 | 3300025921 | Corn Rhizosphere | ESAPRKIAIGRDGETRQQNLEGCKLCKQSLADPDGVLLDLTD |
| Ga0207646_104939153 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KDIENLAVNTPASAARKIAIGREGEKRQKNLEACKLCRHALADPDGVLLDLTD |
| Ga0208911_10169141 | 3300026051 | Natural And Restored Wetlands | PRRVDVGRDGPKHKENLEGCKLCKQGLADPDGVLLDLTD |
| Ga0207641_123050211 | 3300026088 | Switchgrass Rhizosphere | APRRVDIGRDGANHLKNLEACKLCKHALSDPDGVLLDLTD |
| Ga0207676_109005993 | 3300026095 | Switchgrass Rhizosphere | DALGAAHPESAARRVDIGRDGPNHKKNLEACKLCKHALSDPDGVLLDLTD |
| Ga0209690_100207811 | 3300026524 | Soil | SAPTSGARKIAIGRDGERRQKNLEDCKLCKQSLSDPDGVLLDLTD |
| Ga0209799_10063594 | 3300027654 | Tropical Forest Soil | VENLPNTVPGSTARKITIGRDGETRQKNLEACKLCRYPLADPDGVLLDLTD |
| Ga0209177_103972552 | 3300027775 | Agricultural Soil | APASAPRKIAIGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD |
| Ga0307305_100841023 | 3300028807 | Soil | ALAAAAPGSAARKIAIGRDGETRQKNLEGCKLCKQSLADPDGVLLDLTD |
| Ga0310915_106264081 | 3300031573 | Soil | AARRIAIGRDGEKRQKNLEACKLCRHALADPDGVLLDLTD |
| Ga0310813_109975563 | 3300031716 | Soil | KIAIGRDGETRQKNLEGCGLCKHPLADPDGVLLDLTD |
| Ga0307469_112900141 | 3300031720 | Hardwood Forest Soil | RKIDIGREGARRRQNLEACKLGGHATADPDGVLIDLSA |
| Ga0310892_104124933 | 3300031858 | Soil | LAAAAPASAPRKIAIGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD |
| Ga0307412_113552041 | 3300031911 | Rhizosphere | KVAIGRDGEKHKENLEGCKLCKQSLADPDGVLLDLTD |
| Ga0318533_112020111 | 3300032059 | Soil | IAIGRDGETRQKNLEGCRLCKYSLADPDGVLLDLTD |
| Ga0310890_117846931 | 3300032075 | Soil | DTLGAAHPESAARRVDIGRDGPNHMKNLEACKLCKHALSDPDGVLLDLTD |
| Ga0316613_109666261 | 3300033434 | Soil | GAAHPESAARRVDIGRDGPNHLKNLEGCKLCKHALSDPDGVLLDLTD |
| Ga0310811_101410034 | 3300033475 | Soil | KDLEALATAAPASAARKIAIGRDGETRQKNLEGCKLCKQSLSDPDGVLLDLTD |
| Ga0364940_0217018_2_127 | 3300034164 | Sediment | SAARKIAIGRDGPQRQKNLEGCKLCKQPLADPDGVLLDLTD |
| ⦗Top⦘ |