


| Basic Information | |
|---|---|
| Family ID | F089196 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 41 residues |
| Representative Sequence | SVIQLAQPEADPAKPGTWWFWGAADNIRLPAWNAVKLAEKLAE |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 97.25 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.165 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.771 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.90% β-sheet: 14.08% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF04390 | LptE | 78.90 |
| PF06144 | DNA_pol3_delta | 15.60 |
| PF01649 | Ribosomal_S20p | 1.83 |
| PF00293 | NUDIX | 0.92 |
| PF04185 | Phosphoesterase | 0.92 |
| PF02774 | Semialdhyde_dhC | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 78.90 |
| COG1466 | DNA polymerase III, delta subunit | Replication, recombination and repair [L] | 15.60 |
| COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 15.60 |
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 1.83 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.92 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.92 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.17 % |
| Unclassified | root | N/A | 1.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_101244298 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300004157|Ga0062590_101317994 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005176|Ga0066679_10319886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1012 | Open in IMG/M |
| 3300005336|Ga0070680_100743497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300005542|Ga0070732_10665738 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005556|Ga0066707_10152386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1466 | Open in IMG/M |
| 3300005566|Ga0066693_10034566 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300005575|Ga0066702_10223333 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005944|Ga0066788_10011517 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300006034|Ga0066656_10376095 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300006046|Ga0066652_100129070 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
| 3300006176|Ga0070765_100579104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1058 | Open in IMG/M |
| 3300006176|Ga0070765_100678839 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300006797|Ga0066659_10587525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300006854|Ga0075425_102353553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 591 | Open in IMG/M |
| 3300006904|Ga0075424_102825846 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300007076|Ga0075435_102061969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
| 3300007819|Ga0104322_127753 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300009545|Ga0105237_11135781 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300009638|Ga0116113_1066680 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300010043|Ga0126380_10587253 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300010047|Ga0126382_10905316 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300010048|Ga0126373_12653177 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010326|Ga0134065_10362970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300010360|Ga0126372_12900006 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010379|Ga0136449_102172169 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300011269|Ga0137392_10139232 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300011269|Ga0137392_10558112 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300011270|Ga0137391_10693666 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300011270|Ga0137391_11238589 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012198|Ga0137364_10144972 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300012202|Ga0137363_10880572 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012203|Ga0137399_10316881 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300012203|Ga0137399_11022718 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012205|Ga0137362_10530276 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300012206|Ga0137380_11136606 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012211|Ga0137377_11808216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300012361|Ga0137360_10304543 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300012361|Ga0137360_10346861 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300012361|Ga0137360_10734879 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012924|Ga0137413_10343501 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300012925|Ga0137419_10603403 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012927|Ga0137416_10327918 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300012971|Ga0126369_11207208 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300014157|Ga0134078_10062829 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300015054|Ga0137420_1021568 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300015054|Ga0137420_1198181 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300015054|Ga0137420_1259792 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300015264|Ga0137403_11250370 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018468|Ga0066662_12010489 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300018482|Ga0066669_10595751 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300020170|Ga0179594_10267656 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300020579|Ga0210407_10162886 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300020579|Ga0210407_10942547 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300020580|Ga0210403_10377355 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300020581|Ga0210399_10740032 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300021086|Ga0179596_10087475 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300021170|Ga0210400_11222947 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300021171|Ga0210405_10015486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6292 | Open in IMG/M |
| 3300021178|Ga0210408_10952504 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300021181|Ga0210388_11043983 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300021401|Ga0210393_10110117 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300021406|Ga0210386_10298857 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300021474|Ga0210390_11118531 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300024246|Ga0247680_1064374 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300024251|Ga0247679_1051487 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300025929|Ga0207664_11540575 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300026301|Ga0209238_1146479 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300026481|Ga0257155_1034352 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300026530|Ga0209807_1268531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300026555|Ga0179593_1035477 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
| 3300026557|Ga0179587_10281523 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300027516|Ga0207761_1006947 | All Organisms → cellular organisms → Bacteria | 2722 | Open in IMG/M |
| 3300027562|Ga0209735_1077684 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300027629|Ga0209422_1003392 | All Organisms → cellular organisms → Bacteria | 3868 | Open in IMG/M |
| 3300027651|Ga0209217_1157636 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300027671|Ga0209588_1202158 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300027767|Ga0209655_10057398 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300027812|Ga0209656_10363966 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300027867|Ga0209167_10189747 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300027903|Ga0209488_11056222 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300027908|Ga0209006_10963427 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300028047|Ga0209526_10254416 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300029636|Ga0222749_10318097 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300030520|Ga0311372_12009948 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300030737|Ga0302310_10248283 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300030991|Ga0073994_12288095 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031128|Ga0170823_14397558 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300031231|Ga0170824_106846396 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031231|Ga0170824_114853646 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031231|Ga0170824_123286347 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300031446|Ga0170820_16696697 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031474|Ga0170818_107497730 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031682|Ga0318560_10768998 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031715|Ga0307476_11321511 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031718|Ga0307474_10954680 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031770|Ga0318521_10796588 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031823|Ga0307478_11167897 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031823|Ga0307478_11340508 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031835|Ga0318517_10439253 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031890|Ga0306925_12104679 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031954|Ga0306926_10573692 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300031962|Ga0307479_10798326 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300032089|Ga0318525_10662748 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032180|Ga0307471_100011060 | All Organisms → cellular organisms → Bacteria | 6079 | Open in IMG/M |
| 3300032180|Ga0307471_100139050 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
| 3300032180|Ga0307471_101165599 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.92% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.92% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1012442981 | 3300004152 | Bog Forest Soil | HLAKPEEDPARPGAWWLWGAADNIRMPAANAVKLAEMLP* |
| Ga0062590_1013179941 | 3300004157 | Soil | HLAKPEEDPARPGAWWFWGAADNIRLPAANAVKLAEMLP* |
| Ga0066679_103198861 | 3300005176 | Soil | IQLAEAESEPGKPGTWWFWGAADNIRLPAANAVRLAEKLAE* |
| Ga0070680_1007434973 | 3300005336 | Corn Rhizosphere | EKVAHLAKPEEDPARPGAWWFWGAADNIRLPAANAVKLAEMLP* |
| Ga0070732_106657382 | 3300005542 | Surface Soil | KPEEDPARPGAWWFWGAADNIRLPAANAVKLAEMLP* |
| Ga0066707_101523861 | 3300005556 | Soil | PSNVTGAEAVAIQLGAAQGEAAKPGTWWFWGAADNVRLPAANAVKLAEKLAE* |
| Ga0066693_100345661 | 3300005566 | Soil | RADAASPGTWWFWAAADNLHLPAYNAVKLAEKLLE* |
| Ga0066702_102233331 | 3300005575 | Soil | RIQLADPQMDPAGPGIWWFWGAADDIRLPATTAIKLVEKLVA* |
| Ga0066788_100115174 | 3300005944 | Soil | ESAIQLAQPEPDSAQPGTWWFWGAADNIRLPAWNAVKLAEKLTE* |
| Ga0066656_103760953 | 3300006034 | Soil | IQLAEADDEPGKPGTWWFWGAADNIRLPAANAVKLAEKLAE* |
| Ga0066652_1001290701 | 3300006046 | Soil | VAIQLAEAQGEPAKPGTWWFWGAADNVRLPAANAVKLAEKLAE* |
| Ga0070765_1005791043 | 3300006176 | Soil | AHLAKPEEDPARPGTWWFWGAADNIRMPAANAVKLAEMLP* |
| Ga0070765_1006788391 | 3300006176 | Soil | EADPAKPGIWWFWGAADNIRLPAWNAVRLAELLAE* |
| Ga0066659_105875253 | 3300006797 | Soil | LSAPQADPSASGAWWFWSAADNLRLPAANAVKLAEKLLE* |
| Ga0075425_1023535532 | 3300006854 | Populus Rhizosphere | AMQLAPPLPDQLAPGACWFWAAADNLRLPASNAVKLAEKLLQLKPSE* |
| Ga0075424_1028258461 | 3300006904 | Populus Rhizosphere | DPSQPGTWWFWGAADNIRLPAANAVKLAAKLADKVA* |
| Ga0075435_1020619692 | 3300007076 | Populus Rhizosphere | AGEISIQLAPPSPGPFAPGAFWFWAAADNLRIPAANAVKLAEKLLDQKPFE* |
| Ga0104322_1277533 | 3300007819 | Permafrost Soil | IQLSLPEPDASNPETWWFWGAADNMHLPAANAVKLAEMLL* |
| Ga0114945_100651801 | 3300009444 | Thermal Springs | RDAAAPRSWWIWGAADNIRLAAFNALAIAEKLDGQ* |
| Ga0105237_111357811 | 3300009545 | Corn Rhizosphere | PSNVSSAGEISLQLAPPSPDAYAPGAFWFWAPADNLRLSASNAVKLAERLLDQKPSE* |
| Ga0116113_10666803 | 3300009638 | Peatland | GESFLQLAVPDLDTSPPGAWWFWGAADNFRLPAANAVKLAEMLS* |
| Ga0126380_105872533 | 3300010043 | Tropical Forest Soil | LLAKPEPDPAQPGAWWFWGAADNIRLPAANAVKLAEMVS* |
| Ga0126382_109053161 | 3300010047 | Tropical Forest Soil | TSAGELALQLAPPTPDSAARGAFWFWAAADNLRLPASNAVKLAESLLA* |
| Ga0126373_126531771 | 3300010048 | Tropical Forest Soil | VIQLAAPDRDTSRPGSWWFWGAADNVRLPAAHAVKLAEKLGS* |
| Ga0134065_103629701 | 3300010326 | Grasslands Soil | AIQLAEAQGEPAKPGTWWFWGAADNVRLPAANAVKLAEKLAE* |
| Ga0126372_129000062 | 3300010360 | Tropical Forest Soil | PDPSNPGAWWFWAAADNLRLPAANAVKLAEKLLE* |
| Ga0136449_1021721693 | 3300010379 | Peatlands Soil | IQLGIPQSDPLSYGTWWFWGAADNIRLPAWNAVKLAEKLVP* |
| Ga0137392_101392321 | 3300011269 | Vadose Zone Soil | IAQLSKPHADRLQAGSWWFWGAADNIRLPAWNAVKLAEKLMP* |
| Ga0137392_105581121 | 3300011269 | Vadose Zone Soil | PEQDPSRPGTWWIWGAADNIRLPAWNAVKLAEKLVP* |
| Ga0137391_106936663 | 3300011270 | Vadose Zone Soil | SAASETVVQLSKPKADSLQPGSWWFWGAADNIRLPAWNAVKLAEKLVP* |
| Ga0137391_112385892 | 3300011270 | Vadose Zone Soil | AQLSKPHADRLQAGSWWFWGAADNIRLPAWNAVKLAEKLMP* |
| Ga0137364_101449723 | 3300012198 | Vadose Zone Soil | EAESEPGKPGTWWFWGAADNIRLPAANAVRLAEKLAE* |
| Ga0137363_108805721 | 3300012202 | Vadose Zone Soil | DNVSSAGETSLQLAPPRSDPSGPGAWWLWAASDNLRLPAANAVKLAEKLLE* |
| Ga0137399_103168813 | 3300012203 | Vadose Zone Soil | LSKPHADRLQPRSWWFWGAADNIRLPAWNAVKLAEKLVP* |
| Ga0137399_110227181 | 3300012203 | Vadose Zone Soil | PDPGLPGLWWFWGAADNIRVPAVNAVKLAEKLLA* |
| Ga0137362_105302761 | 3300012205 | Vadose Zone Soil | IHLALPESDPAQPRSWWFWGAADNVRVPASTAIKLAEKLAE* |
| Ga0137380_111366062 | 3300012206 | Vadose Zone Soil | SIQLARPEADPSHPGTWWFWGAADNIRLPAWNAVKLAEKLVT* |
| Ga0137377_118082162 | 3300012211 | Vadose Zone Soil | LAEAESEPGKPGTWWFWGAADNIRLPAANAVRLAEKLAE* |
| Ga0137360_103045431 | 3300012361 | Vadose Zone Soil | ESKPGKPGTWWFWGAADNIRLPAANAVRLAEKHAE* |
| Ga0137360_103468611 | 3300012361 | Vadose Zone Soil | IQLARPEAEASLPGSWWIWGAADNIRLPAWNAVKLAEKLAP* |
| Ga0137360_107348792 | 3300012361 | Vadose Zone Soil | DSAIHLALPESDPAQPGSWWFWGAADNVRVPASTAITLAEKLAE* |
| Ga0137413_103435011 | 3300012924 | Vadose Zone Soil | PENDPSEMSTFWLWGAADNIRLPAWNALKLAEKLVP* |
| Ga0137419_106034033 | 3300012925 | Vadose Zone Soil | PQTDSAAPGAWWFWAAADNIRVPAANAIKLAEKLLQ* |
| Ga0137416_103279181 | 3300012927 | Vadose Zone Soil | QPENDPSKGNTFWLWGAADNIRLPAWNAVKLAEKLVP* |
| Ga0126369_112072083 | 3300012971 | Tropical Forest Soil | VAGQEYLALALPERDVAELTWWFWGAADNIRLPAANAVKLAEKLL* |
| Ga0134078_100628293 | 3300014157 | Grasslands Soil | AEAQVEPAKPGTWWFWGAADNVRLPAANAVKLAEKLAE* |
| Ga0137420_10215682 | 3300015054 | Vadose Zone Soil | SAIHLALPESDPAQPAAWWFWGAADNVRVPASTAIKLAEKLAE* |
| Ga0137420_11981811 | 3300015054 | Vadose Zone Soil | IQLSKPHADQLQPGSWWFWGAADNIRLPAWHAVKLAEKLMP* |
| Ga0137420_12597923 | 3300015054 | Vadose Zone Soil | VLQLAPPQTDSAAPGAWWFWAAADNIRVPAANAIKLAEKLLQ* |
| Ga0137403_112503701 | 3300015264 | Vadose Zone Soil | SPGETALQLAPPRPDPSSPGTWWFWAAADNLRLPAANAVKLAEKLLE* |
| Ga0066662_120104891 | 3300018468 | Grasslands Soil | QPKHDTSEMNTWWFWGAADNIRLPTWNAVKLAEKLMT |
| Ga0066669_105957511 | 3300018482 | Grasslands Soil | GEKAIQFAQTKADPAYPGTWWFWGAADNIRLPAWNAVKLAEKLA |
| Ga0179594_102676561 | 3300020170 | Vadose Zone Soil | LLAKPEADPSQPGGRWFWGAADNIRLPAANAVKLAEMLA |
| Ga0210407_101628863 | 3300020579 | Soil | ALPESDPGQPGTWWLWGAADNIRLPAATAIKLAEKVVE |
| Ga0210407_109425471 | 3300020579 | Soil | KVAHLAKPEEDPARHGAWLFWGAADNIRMPAANAVRLAEMLP |
| Ga0210403_103773551 | 3300020580 | Soil | AVQLAQAEPDPAKPGTWWFWGAADNIRLPAWNAVKLAEKFTE |
| Ga0210399_107400322 | 3300020581 | Soil | LAQPEADPAKPGIWWFWGAADNIRLPAWNAFRLAELLAE |
| Ga0179596_100874751 | 3300021086 | Vadose Zone Soil | NISAAVETVIQLSKPHADHLQPGSWWFWGAADNIRLPAWNAVKLAEKLVR |
| Ga0210400_112229472 | 3300021170 | Soil | DSSIHLALPDSDSAQSSTWWFWGAADNIRLPAATAIKLAEKLVE |
| Ga0210405_100154861 | 3300021171 | Soil | GEKVPRLALPEEDPARPGAWWFWGAADNIRMPAANAVKLAEMLP |
| Ga0210408_109525042 | 3300021178 | Soil | TVVLAPASPDPARPGSWWFWGAADNIRLPAWNAVKLAEKLAE |
| Ga0210388_110439832 | 3300021181 | Soil | EAEADPAKPGTWWFWGAADNIRLPAWNAVKLAEKLAE |
| Ga0210393_101101171 | 3300021401 | Soil | LSKPKADQLQPGSWWFWGAADNIRLPAWNAVKLAEKLVP |
| Ga0210386_102988571 | 3300021406 | Soil | LALPESDPAQPGTWWFWGAADNIRLPAATAIKLAEKLVE |
| Ga0210390_111185311 | 3300021474 | Soil | TRDEAVPGIWWFWGAADNIRLRAWNAVKLVETLAEKLAE |
| Ga0210402_115700492 | 3300021478 | Soil | AAPELDSAASCVWWLWGAADNIRLPAFNAIKLAEKLLA |
| Ga0247680_10643742 | 3300024246 | Soil | VAGESFAQLAAPELDPSGANLWWFFGAADNIRLPAYNAVKLAEKLLP |
| Ga0247679_10514872 | 3300024251 | Soil | AKPEQDSARPGAWWFWGAADNIRLPAANAVKLAEMLP |
| Ga0207664_115405751 | 3300025929 | Agricultural Soil | ATEPAAAGIWWFWGAADNIRVRAWNAVKLAETLVEKFAE |
| Ga0209238_11464791 | 3300026301 | Grasslands Soil | QLAEAQVEPAKPGTWWFWGAADNVRLPAANAVKLAEKLAE |
| Ga0257155_10343521 | 3300026481 | Soil | ENTIHLAQPEADTSQPGTWWFWGAADNIRLPAWNAVKLAEKLVP |
| Ga0209807_12685312 | 3300026530 | Soil | TAAEAVAIQLAEAQVEPAKPGTWWFWGAADNVRLPAANAVKLAEKLAE |
| Ga0179593_10354775 | 3300026555 | Vadose Zone Soil | VTAAGEKVIQLAYPEGDLHTGKRWLFWGAADNIRLPAWNAVKLAEKLA |
| Ga0179587_102815231 | 3300026557 | Vadose Zone Soil | AGEKSIALSPPELDSSAPGTFWFWGAADNIRLPAWNAVKLAEKLVP |
| Ga0207761_10069475 | 3300027516 | Tropical Forest Soil | VPEADAVRAGAWWFWGAADNLRLPAWNAVKLAEKIEG |
| Ga0209735_10776841 | 3300027562 | Forest Soil | SNISVSGLNSVQLSAPEPDASNPETWWFWGAADNMHLPAANAVKLAEMLL |
| Ga0209422_10033921 | 3300027629 | Forest Soil | SGLNSIQLSAPEPDASNPETWWFWGAADNMHLPAANAVKLAEMLL |
| Ga0209217_11576361 | 3300027651 | Forest Soil | PEADSAQPNNWWLWGAADNIRLPAATAVKLAEKLLA |
| Ga0209588_12021581 | 3300027671 | Vadose Zone Soil | ALPESDPAQANTWWFWGAADNIRVPAAAAIKLAEKLVE |
| Ga0209655_100573983 | 3300027767 | Bog Forest Soil | QLAVPELDTSPPGAWWFWGAADNFRLPAANAVKLAEMLS |
| Ga0209656_103639662 | 3300027812 | Bog Forest Soil | RVSHLAKPEEDPARPGAWWLWGAADNIRMPAANAVKLAEMLP |
| Ga0209167_101897473 | 3300027867 | Surface Soil | EIAVQLAPPQPDPSSPGTWWFWAAADNLRLPAANAVKLAEKLLE |
| Ga0209488_110562221 | 3300027903 | Vadose Zone Soil | GETLLQLAAPQPDAASPGAWWFWAAADNLRLPAANAVKLAEKLLE |
| Ga0209006_109634272 | 3300027908 | Forest Soil | QLSLPKPDASNPETWWFWGAADNMHLPAANAVKLAEMLL |
| Ga0209526_102544161 | 3300028047 | Forest Soil | VSGLNSIQLSVPKPDASNPETWWFWGAADNMHLPTANAVKLAEMLS |
| Ga0222749_103180971 | 3300029636 | Soil | EESTVVLAPASPDPARPGSWWFWGAADNIRLPAWNAVKLAEKLVE |
| Ga0311372_120099482 | 3300030520 | Palsa | AGESTLQLAVPELDTSAPGAWWFWGAADNFRLPATHAVKLAEMLS |
| Ga0302310_102482833 | 3300030737 | Palsa | EGMLQLAPPASDAARPGTWWFWGAADNVRLPAANAVKLADLLAG |
| Ga0073994_122880951 | 3300030991 | Soil | SGLNSIQLSMPEPDASNPETWWFWGAADNMRLPAANAVKLAEMLL |
| Ga0170823_143975581 | 3300031128 | Forest Soil | LQLAPPRPDPSTPGTWWFWTAADNLRLPAANAVKLAEKLLE |
| Ga0170824_1068463961 | 3300031231 | Forest Soil | KPEEDPARPGAWWFWGAADNIRWPAANAVKLAEMLP |
| Ga0170824_1148536462 | 3300031231 | Forest Soil | SSISSAGETVLQLAPPAVDPFKAGAWWFWASADNLRLPAANAIKLAEKLLE |
| Ga0170824_1232863473 | 3300031231 | Forest Soil | LSLPEPDASNPETWWFWGAADNMHLPAANAVKLAEMLL |
| Ga0170820_166966972 | 3300031446 | Forest Soil | DEAVPGIWWFWGAADNIRLRAWNAVKLVETLAEKLAE |
| Ga0170818_1074977302 | 3300031474 | Forest Soil | SISSAGETVLQLAPPAVDPFKAGAWWFWASADNLRLPAANAIKLAEKLLE |
| Ga0318560_107689981 | 3300031682 | Soil | ELQLAKPFADPASPGAWWFWAAADNLRVPAANAVKLAEKLLE |
| Ga0307476_113215112 | 3300031715 | Hardwood Forest Soil | VQLAQAEPDPAKPGTWWFWGAADNIRLPAWNAVKLAEKVAE |
| Ga0307474_109546802 | 3300031718 | Hardwood Forest Soil | TAPELDPMPPGAWWFWGAADNFRLPAANAVKLAEMLS |
| Ga0318521_107965881 | 3300031770 | Soil | AAPDRDTSRPGSWWFWGAADNVRLPAANAVKLAEKLGS |
| Ga0307478_111678972 | 3300031823 | Hardwood Forest Soil | ESDPAQLNTWWFWGAADNIRLPAATAVKLAEKLVE |
| Ga0307478_113405082 | 3300031823 | Hardwood Forest Soil | SVIQLAQPEADPAKPGTWWFWGAADNIRLPAWNAVKLAEKLAE |
| Ga0318517_104392531 | 3300031835 | Soil | PQADATVHGTWWFWGAADNLRLPAWNAVKLAEKLL |
| Ga0306925_121046792 | 3300031890 | Soil | PEPDAEGAGTWWFWGAADNLRLPAWNAVKLAEKIEG |
| Ga0306926_105736923 | 3300031954 | Soil | CAGEVSLQLAPPTRDLSNPAAWWFWAAADNVRLPAMNAVKLAEKLLE |
| Ga0307479_107983262 | 3300031962 | Hardwood Forest Soil | TVAGEKVIQLAYPEGDLHTAGRWFFWGAADNIRLPAWNAVKLAEKLVP |
| Ga0318525_106627481 | 3300032089 | Soil | NTLQLGVPQADATVHGTWWFWGAADNLRLPAWNAVKLAEKLL |
| Ga0307471_1000110601 | 3300032180 | Hardwood Forest Soil | LPESDSAQRGTWWFWGAADNIRLPAATAIKLAEKLFE |
| Ga0307471_1001390504 | 3300032180 | Hardwood Forest Soil | ESDPAQPSTWWFWGAADNIRLPAATAIKLAENIVG |
| Ga0307471_1011655993 | 3300032180 | Hardwood Forest Soil | LALPESDSAQPGTWWFWGAADNIRLPAATAIKLAEKLFE |
| ⦗Top⦘ |