


| Basic Information | |
|---|---|
| Family ID | F089045 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MKDLLKNKKVWIGAAVVVIIFAWVLWSGQPAPEVAQ |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.13 % |
| % of genes near scaffold ends (potentially truncated) | 10.09 % |
| % of genes from short scaffolds (< 2000 bps) | 71.56 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.881 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (28.440 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.560 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.413 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF07068 | Gp23 | 11.93 |
| PF00471 | Ribosomal_L33 | 7.34 |
| PF00574 | CLP_protease | 4.59 |
| PF00490 | ALAD | 3.67 |
| PF13186 | SPASM | 0.92 |
| PF01970 | TctA | 0.92 |
| PF02622 | DUF179 | 0.92 |
| PF13394 | Fer4_14 | 0.92 |
| PF00149 | Metallophos | 0.92 |
| PF12849 | PBP_like_2 | 0.92 |
| PF05050 | Methyltransf_21 | 0.92 |
| PF07230 | Portal_Gp20 | 0.92 |
| PF13353 | Fer4_12 | 0.92 |
| PF13506 | Glyco_transf_21 | 0.92 |
| PF06945 | DUF1289 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 9.17 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 9.17 |
| COG0267 | Ribosomal protein L33 | Translation, ribosomal structure and biogenesis [J] | 7.34 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 4.59 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 3.67 |
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.92 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.92 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 0.92 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.88 % |
| All Organisms | root | All Organisms | 43.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10147156 | Not Available | 783 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1054028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 594 | Open in IMG/M |
| 3300001460|JGI24003J15210_10077390 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300001472|JGI24004J15324_10144387 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 557 | Open in IMG/M |
| 3300001956|GOS2266_1021600 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1688 | Open in IMG/M |
| 3300001958|GOS2232_1038323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1697 | Open in IMG/M |
| 3300002488|JGI25128J35275_1094575 | Not Available | 606 | Open in IMG/M |
| 3300005522|Ga0066861_10003746 | All Organisms → cellular organisms → Bacteria | 5489 | Open in IMG/M |
| 3300005523|Ga0066865_10092011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1093 | Open in IMG/M |
| 3300005523|Ga0066865_10123189 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 950 | Open in IMG/M |
| 3300005523|Ga0066865_10126880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 937 | Open in IMG/M |
| 3300005606|Ga0066835_10104662 | Not Available | 908 | Open in IMG/M |
| 3300005608|Ga0066840_10016871 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300005837|Ga0078893_10277512 | Not Available | 2088 | Open in IMG/M |
| 3300005837|Ga0078893_10875360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 520 | Open in IMG/M |
| 3300005960|Ga0066364_10156838 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 781 | Open in IMG/M |
| 3300005960|Ga0066364_10295294 | Not Available | 568 | Open in IMG/M |
| 3300006024|Ga0066371_10139507 | Not Available | 741 | Open in IMG/M |
| 3300006025|Ga0075474_10251428 | Not Available | 532 | Open in IMG/M |
| 3300006305|Ga0068468_1145279 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 879 | Open in IMG/M |
| 3300006334|Ga0099675_1668049 | Not Available | 502 | Open in IMG/M |
| 3300006738|Ga0098035_1071279 | Not Available | 1238 | Open in IMG/M |
| 3300006749|Ga0098042_1172122 | Not Available | 525 | Open in IMG/M |
| 3300006874|Ga0075475_10178872 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 918 | Open in IMG/M |
| 3300007152|Ga0101672_1045348 | Not Available | 748 | Open in IMG/M |
| 3300007276|Ga0070747_1163861 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 795 | Open in IMG/M |
| 3300007504|Ga0104999_1061442 | All Organisms → Viruses → Predicted Viral | 1631 | Open in IMG/M |
| 3300007623|Ga0102948_1281253 | Not Available | 509 | Open in IMG/M |
| 3300009027|Ga0102957_1187114 | Not Available | 740 | Open in IMG/M |
| 3300009103|Ga0117901_1161821 | Not Available | 1237 | Open in IMG/M |
| 3300009481|Ga0114932_10389231 | Not Available | 828 | Open in IMG/M |
| 3300009593|Ga0115011_10000691 | Not Available | 26304 | Open in IMG/M |
| 3300009593|Ga0115011_10119895 | Not Available | 1880 | Open in IMG/M |
| 3300009593|Ga0115011_10770798 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 794 | Open in IMG/M |
| 3300009790|Ga0115012_11616621 | Not Available | 561 | Open in IMG/M |
| 3300012919|Ga0160422_10001601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 14155 | Open in IMG/M |
| 3300012919|Ga0160422_10064765 | Not Available | 2130 | Open in IMG/M |
| 3300012919|Ga0160422_10085249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → unclassified Roseibacillus → Roseibacillus sp. | 1852 | Open in IMG/M |
| 3300012920|Ga0160423_10116350 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1885 | Open in IMG/M |
| 3300012928|Ga0163110_10003171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8606 | Open in IMG/M |
| 3300012953|Ga0163179_10041530 | All Organisms → cellular organisms → Bacteria | 3139 | Open in IMG/M |
| 3300012953|Ga0163179_10985211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300013230|Ga0116814_1052555 | Not Available | 534 | Open in IMG/M |
| 3300016745|Ga0182093_1347518 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300017697|Ga0180120_10119021 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300017708|Ga0181369_1031290 | Not Available | 1252 | Open in IMG/M |
| 3300017709|Ga0181387_1017756 | Not Available | 1378 | Open in IMG/M |
| 3300017709|Ga0181387_1063608 | Not Available | 740 | Open in IMG/M |
| 3300017714|Ga0181412_1004535 | Not Available | 4664 | Open in IMG/M |
| 3300017724|Ga0181388_1039033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1159 | Open in IMG/M |
| 3300017730|Ga0181417_1008659 | Not Available | 2661 | Open in IMG/M |
| 3300017731|Ga0181416_1046841 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300017735|Ga0181431_1098362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 656 | Open in IMG/M |
| 3300017744|Ga0181397_1003359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5428 | Open in IMG/M |
| 3300017746|Ga0181389_1033351 | Not Available | 1559 | Open in IMG/M |
| 3300017746|Ga0181389_1089124 | Not Available | 859 | Open in IMG/M |
| 3300017764|Ga0181385_1006714 | Not Available | 3813 | Open in IMG/M |
| 3300017779|Ga0181395_1163265 | Not Available | 699 | Open in IMG/M |
| 3300017824|Ga0181552_10139070 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300017958|Ga0181582_10647923 | Not Available | 641 | Open in IMG/M |
| 3300020176|Ga0181556_1283042 | Not Available | 576 | Open in IMG/M |
| 3300020247|Ga0211654_1001828 | Not Available | 3793 | Open in IMG/M |
| 3300020251|Ga0211700_1040339 | Not Available | 501 | Open in IMG/M |
| 3300020278|Ga0211606_1030518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1140 | Open in IMG/M |
| 3300020278|Ga0211606_1052122 | Not Available | 822 | Open in IMG/M |
| 3300020299|Ga0211615_1035311 | Not Available | 739 | Open in IMG/M |
| 3300020341|Ga0211592_1033017 | Not Available | 1103 | Open in IMG/M |
| 3300020368|Ga0211674_10066244 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 967 | Open in IMG/M |
| 3300020374|Ga0211477_10002372 | Not Available | 10852 | Open in IMG/M |
| 3300020380|Ga0211498_10063554 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300020381|Ga0211476_10257978 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 602 | Open in IMG/M |
| 3300020397|Ga0211583_10124836 | Not Available | 958 | Open in IMG/M |
| 3300020410|Ga0211699_10010720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 3738 | Open in IMG/M |
| 3300020410|Ga0211699_10094820 | Not Available | 1107 | Open in IMG/M |
| 3300020410|Ga0211699_10148687 | Not Available | 882 | Open in IMG/M |
| 3300020419|Ga0211512_10053400 | Not Available | 1938 | Open in IMG/M |
| 3300020420|Ga0211580_10000047 | All Organisms → cellular organisms → Bacteria | 86865 | Open in IMG/M |
| 3300020421|Ga0211653_10045260 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2007 | Open in IMG/M |
| 3300020436|Ga0211708_10006023 | Not Available | 4535 | Open in IMG/M |
| 3300020438|Ga0211576_10410817 | Not Available | 691 | Open in IMG/M |
| 3300020446|Ga0211574_10502798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 520 | Open in IMG/M |
| 3300020448|Ga0211638_10007704 | Not Available | 4547 | Open in IMG/M |
| 3300020448|Ga0211638_10060157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → unclassified Roseibacillus → Roseibacillus sp. | 1664 | Open in IMG/M |
| 3300020468|Ga0211475_10027976 | Not Available | 3203 | Open in IMG/M |
| 3300020470|Ga0211543_10059707 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1999 | Open in IMG/M |
| 3300020471|Ga0211614_10356263 | Not Available | 644 | Open in IMG/M |
| 3300020474|Ga0211547_10085639 | Not Available | 1661 | Open in IMG/M |
| 3300021356|Ga0213858_10123150 | Not Available | 1267 | Open in IMG/M |
| 3300021365|Ga0206123_10201746 | Not Available | 884 | Open in IMG/M |
| 3300021958|Ga0222718_10022829 | All Organisms → Viruses → Predicted Viral | 4305 | Open in IMG/M |
| 3300021964|Ga0222719_10249672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203 | 1180 | Open in IMG/M |
| 3300024297|Ga0228658_1098385 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 722 | Open in IMG/M |
| 3300025072|Ga0208920_1052140 | Not Available | 813 | Open in IMG/M |
| 3300025120|Ga0209535_1010723 | Not Available | 5166 | Open in IMG/M |
| 3300025120|Ga0209535_1012212 | All Organisms → Viruses → Predicted Viral | 4743 | Open in IMG/M |
| 3300025120|Ga0209535_1041056 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
| 3300025120|Ga0209535_1195660 | Not Available | 575 | Open in IMG/M |
| 3300025127|Ga0209348_1013225 | Not Available | 3233 | Open in IMG/M |
| 3300025653|Ga0208428_1019423 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2250 | Open in IMG/M |
| 3300026077|Ga0208749_1055016 | Not Available | 837 | Open in IMG/M |
| 3300026189|Ga0208405_1028743 | Not Available | 861 | Open in IMG/M |
| 3300027906|Ga0209404_10424414 | Not Available | 870 | Open in IMG/M |
| 3300029319|Ga0183748_1023319 | Not Available | 2140 | Open in IMG/M |
| 3300029319|Ga0183748_1096831 | Not Available | 686 | Open in IMG/M |
| 3300029448|Ga0183755_1011200 | All Organisms → cellular organisms → Bacteria | 3497 | Open in IMG/M |
| 3300029448|Ga0183755_1018880 | Not Available | 2344 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 28.44% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.69% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.01% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.59% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.59% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.75% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 2.75% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.83% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.83% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.83% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.83% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.92% |
| Water Column | Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.92% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.92% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 0.92% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.92% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.92% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001956 | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 | Environmental | Open in IMG/M |
| 3300001958 | Marine microbial communities from Gulf of Mexico, USA - GS016 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007152 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', waterEBds3 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007504 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013230 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station5_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
| 3300020278 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556076-ERR599151) | Environmental | Open in IMG/M |
| 3300020299 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX555923-ERR599016) | Environmental | Open in IMG/M |
| 3300020341 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555908-ERR599066) | Environmental | Open in IMG/M |
| 3300020368 | Marine microbial communities from Tara Oceans - TARA_B100001027 (ERX556049-ERR599093) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026189 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_101471563 | 3300000117 | Marine | MKDLMKNKKVWIGAAVVVIIFAWMLWSGSPAPVEAQ* |
| LP_A_09_P04_10DRAFT_10540282 | 3300000265 | Marine | MKNMMKNKKLWIGIAVVIAVAWFMWSGQPAPEVTQ* |
| JGI24003J15210_100773902 | 3300001460 | Marine | MKDLMKNKKVWIGAAVVVIIFAWMLWSGQPAPVEAQ* |
| JGI24004J15324_101443871 | 3300001472 | Marine | MKDMMKNKKVWIGIAIVIAVAWFMWSGQPAPEVTQ* |
| GOS2266_10216001 | 3300001956 | Marine | RYKMKKMLKSKKTWIAVAVVVIVFAWVLWSGQPAPEVTQ* |
| GOS2232_10383232 | 3300001958 | Marine | MKDFIKNKKVWIGAAIVIIVIGWAVWSGQPAPEVVQ* |
| JGI25128J35275_10945752 | 3300002488 | Marine | MGGNNMKDLMKNKKVWIGAAVVVIIFAWMLWSGSPAPVEAQ* |
| Ga0074648_100273415 | 3300005512 | Saline Water And Sediment | MKELLKDKKTWIAIAIIVVIAWSVWSGQPTPEVTQ* |
| Ga0066861_100037466 | 3300005522 | Marine | MKAFLKSKKTWIAVAVVVVVFAWVLWSGQPAPEVTQ* |
| Ga0066865_100920112 | 3300005523 | Marine | MKKMLKSKKTWIAVAVVVIVFAWVLWSGQPAPEVTQ* |
| Ga0066865_101231892 | 3300005523 | Marine | MKKLLKSKKTWIAIAVVVVVVAWALWSGQPAPEVTQ* |
| Ga0066865_101268802 | 3300005523 | Marine | MKDFLKNKKVWVGAAVVVIIFAWVLWSGQPAPVEAQ* |
| Ga0066835_101046622 | 3300005606 | Marine | MKNFLKNKKVWIGIAIVIIAIGWAVWSGQPAPEVQG* |
| Ga0066840_100168712 | 3300005608 | Marine | MKHLKNKKLWIGVAIVVIVFAWAIWSGQPAPEVQG* |
| Ga0078893_102775122 | 3300005837 | Marine Surface Water | MKAFLKSKKTWIAVAVVVIVFAYVLWTGQPAPEVTQ* |
| Ga0078893_108753602 | 3300005837 | Marine Surface Water | MKDWMKNKKVWIGAAVVVIVFAWMLWSGSPAPVEAQ* |
| Ga0066364_101568382 | 3300005960 | Marine | MKAFLKSKKTWIAVAVVVIVFAYVLWSGQPAPEVTQ* |
| Ga0066364_102952942 | 3300005960 | Marine | MKAFLKSKKTWIAVAVVVIVFAWVLWSGQPAPEVTQ* |
| Ga0066371_101395072 | 3300006024 | Marine | MKMKDLMKNKKVWIAVAVVVVVFAWAMMGGSPAPEVTQ* |
| Ga0075474_102514282 | 3300006025 | Aqueous | MKQLLKDKKTWIAIAIVVVIAWALWSGQPAPEITQ* |
| Ga0068468_11452792 | 3300006305 | Marine | MKNFLKNKKVWIGIAIVIIAIGWAVWSGQPSPEVQG* |
| Ga0099675_16680492 | 3300006334 | Marine | MKDFIKNKKVWIGAAVVIIVIGWALWSGQPAPEVAQ* |
| Ga0098035_10712792 | 3300006738 | Marine | MKDLMKNKKVWVAVAIVVIIIAWTILSGNPAPEVTQ* |
| Ga0098042_11721222 | 3300006749 | Marine | MKHLKDKKIWIGAAVVVIIFAWMLWSGQPAPEVQG* |
| Ga0075475_101788722 | 3300006874 | Aqueous | ISKHKDNIMKKFFKDKKVWIAIAVVVIAGAWFIWSGQPAPEVQG* |
| Ga0101672_10453483 | 3300007152 | Volcanic Co2 Seeps | MKKMLKSKKTWIAVAVVVILFAWLLWSGQPAPEVTQ* |
| Ga0070747_11638613 | 3300007276 | Aqueous | MKNLMKNKKVWIGAAVVVIVFAWMLWSGQPAPVEAQ* |
| Ga0104999_10614423 | 3300007504 | Water Column | MKDFIKNKKVWIGIAVVIIVIGWVVWSGQPAPEIQG* |
| Ga0102948_12812531 | 3300007623 | Water | MKDLMKNKKVWIGAAVIVIIFAWMLWSGSPAPVEAQ* |
| Ga0102957_11871143 | 3300009027 | Pond Water | MKDLMKNKKVWIGAPVVVIIFAWMLWSGSPAPVEAQ* |
| Ga0117901_11618211 | 3300009103 | Marine | DLMKNKKVWIAVAIVVVVFAWAMMGGDPAPEVTQ* |
| Ga0114932_103892312 | 3300009481 | Deep Subsurface | MKDFIKNKKVWIGVAIVIIVIGWAVWSGQPAPEVAQ* |
| Ga0115011_100006915 | 3300009593 | Marine | MKDMMKSKKFWIAVAVVVIIFGYTMWTGQPAPEVAQ* |
| Ga0115011_101198953 | 3300009593 | Marine | MKHLKDKKLWIGAAVVVIIFAWMLWSGQPAPEVQG* |
| Ga0115011_107707981 | 3300009593 | Marine | MKHLKDKKIWIGAAVVVILFAWMLWSGQPAPEVQS* |
| Ga0115012_116166211 | 3300009790 | Marine | MKDLLKNKKVWIGAAVVVIIFAWVLWSGQPAPVEAQ* |
| Ga0160422_1000160114 | 3300012919 | Seawater | MKHLKDKKLWIGAAVVVIIFAWVLWSGQPAPEVQG* |
| Ga0160422_100647653 | 3300012919 | Seawater | MKDFLKNKKVWIGAAIVVIVIAWAVWSGQPAPEVAQ* |
| Ga0160422_100852492 | 3300012919 | Seawater | MKDWKNWMKNKKVWIGAAIVIIVFAWALWSGMQPPVEEIK* |
| Ga0160423_101163503 | 3300012920 | Surface Seawater | MKELMKNKKAWAAVVILVVVAWALWSGQPAPEVAQ* |
| Ga0163110_1000317110 | 3300012928 | Surface Seawater | MKDFMKNKKVWIGAAIVVIIFAWALWSGSPAPVEAQ* |
| Ga0163179_100415303 | 3300012953 | Seawater | MKDLMKNKKVWIGVAVVIALAWFMWSGQPAPEVQ* |
| Ga0163179_109852113 | 3300012953 | Seawater | VEEIIMKHLKDKKLWIGAAVVVIIFAWMLWSGQPAPEVQG* |
| Ga0129343_12913372 | 3300012967 | Aqueous | MKELLKDKTTWIAIAIIVVIAWSVWSGQPTPEVTQ* |
| Ga0116814_10525551 | 3300013230 | Marine | MKAFLKSKKTWIAVAVVVVVFAWALWSGQPAPEVTQ* |
| Ga0182093_13475183 | 3300016745 | Salt Marsh | MKDLMKNKEVWIGAAVVVIIFAWMLWSGSPAPVEAQ |
| Ga0180120_101190211 | 3300017697 | Freshwater To Marine Saline Gradient | MKNLMKNKKVWIGAAVVVIIFAWMLWSGQPAPVEAQ |
| Ga0181369_10312902 | 3300017708 | Marine | MKDLMKNKKVWIGAAVVVIIFAWMLWSGQPAPEVQ |
| Ga0181387_10177564 | 3300017709 | Seawater | MKDFMKNKKVWIGIAVVIIVIGWAVWSGQPTPEVAQ |
| Ga0181387_10636082 | 3300017709 | Seawater | MKDFIKNKKVWIGIAVVIIVIGWAVWSGQPAPEVAQ |
| Ga0181412_10045355 | 3300017714 | Seawater | MKHLKDKKLWIGAAVVVIVFAWMLWSGQPAPEVQG |
| Ga0181388_10390331 | 3300017724 | Seawater | KDFIKNKKVWIGIAVVIIVIGWAVWSGQPAPEVAQ |
| Ga0181417_10086592 | 3300017730 | Seawater | MKDFIKNKKVWIGIAIVIIVIGWAVWSGQPAPEVAQ |
| Ga0181416_10468414 | 3300017731 | Seawater | MKNFMKNKKVWIGAAVVVIIFAWMLWSGQPAPVEAQSF |
| Ga0181431_10983621 | 3300017735 | Seawater | MKNFMKNKKVWIGAAVVVIVFAWMLWSGQPAPVEAQ |
| Ga0181397_10033593 | 3300017744 | Seawater | MKHLKNKKLWIGAAVVVIIFAWMLWSGQPAPEVQG |
| Ga0181389_10333515 | 3300017746 | Seawater | MKNFLKNKKVWVGAAVVVIIFAWMLWSGQPAPVEAQ |
| Ga0181389_10891242 | 3300017746 | Seawater | MKDFIKNKKVWIGIAVVIIVIGWAVWSGQPTPEVAQ |
| Ga0181385_10067142 | 3300017764 | Seawater | MKDFIKNKKVWIGAAVVVIIFAWVLWSGQPAPVEAQ |
| Ga0181395_11632653 | 3300017779 | Seawater | MKNFMKNKKVWIGAAVVVIIFAWMLWSGQPVPVEAQ |
| Ga0181552_101390705 | 3300017824 | Salt Marsh | MKDLMKNKKVWIGAAVVVIIFAWMLWSGSPAPVEAQ |
| Ga0181582_106479232 | 3300017958 | Salt Marsh | MKKLLKSKKTWIAIAVVVVVVAWALWSGQPAPEVTQ |
| Ga0181585_100003013 | 3300017969 | Salt Marsh | MKELLKDKKTWIAIAIIVVIAWSVWSGQPTPEVTQ |
| Ga0181556_12830424 | 3300020176 | Salt Marsh | KMKDLMKNKKVWIGAAVVVIIFAWMLWSGSPAPVEAQ |
| Ga0211654_10018283 | 3300020247 | Marine | MKDMMKSKKFWIAVAVVVIIFGYTMWTGQPAPEVAQ |
| Ga0211700_10403391 | 3300020251 | Marine | MKDLLKNKKVWIGVAVVIIVIGWALWSGQPAPEVAQ |
| Ga0211606_10305182 | 3300020278 | Marine | MKKMLKSKKTWIAVAVVVIVFAWVLWSGQPAPEVTQ |
| Ga0211606_10521222 | 3300020278 | Marine | MKDFIKNKKVWIGAAIVVIVIAWAVWSGQPAPEVAQ |
| Ga0211615_10353113 | 3300020299 | Marine | MKDFIKNKKVWIGAAIVIIVIGWAVWSGQPAPEVAQ |
| Ga0211592_10330175 | 3300020341 | Marine | RLPIGGYKMKDFIKNKKVWIGAAIVVIVIAWAVWSGQPAPEVAQ |
| Ga0211674_100662443 | 3300020368 | Marine | MKNFFKNKKVWIGIAVVIIAIGWAVWSGQPAPEVQG |
| Ga0211477_1000237217 | 3300020374 | Marine | MKDFIKNKKVWIGVAIVIIVIGWAVWSGQPAPEVAQ |
| Ga0211498_100635542 | 3300020380 | Marine | MKDLLKNKKVWIGAAVVVIIFAWVLWSGQPAPVEAQ |
| Ga0211476_102579782 | 3300020381 | Marine | MKAFLKSKKTWIAVAVVVIVFAYVLWSGQPAPEVTQ |
| Ga0211583_101248363 | 3300020397 | Marine | MKDWMKNKKVWIGAAVVIIVFAWALWSGMQPPVEEIK |
| Ga0211699_100107209 | 3300020410 | Marine | MKDLLKNKKVWIGAAVVVIIFAWVLWSGQPAPEVAQ |
| Ga0211699_100948203 | 3300020410 | Marine | MKDFIKNKKVWIGAAVVIIVIGWALWSGQPAPEVAQ |
| Ga0211699_101486873 | 3300020410 | Marine | MKDFIKNKKVWIGAAVVVIIFAWALWSGQPAPVEAQ |
| Ga0211512_100534006 | 3300020419 | Marine | MKDFLKNKKVWVGAAVVVIIFAWVLWSGQPAPVEAQ |
| Ga0211580_1000004775 | 3300020420 | Marine | MKNFFKSKKVWIGIAIVVIAIGWAVWSGQPAPEVQG |
| Ga0211653_100452603 | 3300020421 | Marine | MKHLKDKKIWIGAAVVVIIFAWMLWSGQPAPEVQG |
| Ga0211708_100060233 | 3300020436 | Marine | MKHLKDKKLWIGAAVVVIIFAWVLWSGQPAPEVQG |
| Ga0211576_104108172 | 3300020438 | Marine | MKNFMKNKKVWIGAAVVVIIFAWMLWSGQPAPVEAQ |
| Ga0211574_105027983 | 3300020446 | Marine | MKDFMKNKKVWIGAAIVVIIFAWALWSGSPAPVEAQ |
| Ga0211638_100077043 | 3300020448 | Marine | MKHLKDKKLWIGAAIVIIIFAYVLWSGQPAPEVQG |
| Ga0211638_100601574 | 3300020448 | Marine | MKDWMKNKKVWIGAAIVIIVFAWALWSGMQPPVEEIK |
| Ga0211475_100279765 | 3300020468 | Marine | MKHLKDKKLWIGAAIVVIIFAWMLWSGQPAPEVQG |
| Ga0211543_100597074 | 3300020470 | Marine | MKKLLKNKKTWIAIAVVVVVVAWALWSGQPAPEVTQ |
| Ga0211614_103562632 | 3300020471 | Marine | MKDLMKNKKVWIAVAIVVVVFAWAMMGGEPTPEVTQ |
| Ga0211547_100856394 | 3300020474 | Marine | MKDFLKNKKVWIGAAVVVIIFAWVLWSGQPAPEVAQ |
| Ga0213858_101231503 | 3300021356 | Seawater | MKNFFRNKKVWIAVAIVVIAGAWFMWSGQPAPEVQG |
| Ga0206123_102017462 | 3300021365 | Seawater | MGGNNMKDLMKNKKVWIGAAVVVIIFAWMLWSGSPAPVEAQ |
| Ga0222718_100228293 | 3300021958 | Estuarine Water | MKDLMKNKKVWIGAAVIVIIFAWMLWSGSPAPVEAQ |
| Ga0222719_102496722 | 3300021964 | Estuarine Water | MKQLLKDKKTWIAIAIVVVIAWALWSGQPAPEITQ |
| Ga0228658_10983852 | 3300024297 | Seawater | MKHLKDKKLWIGAAVVVIIFAWMLWSGQPAPEVQG |
| Ga0208920_10521403 | 3300025072 | Marine | MKDLMKNKKVWVAVAIVVIIIAWTILSGNPAPEVTQ |
| Ga0209535_10107234 | 3300025120 | Marine | MKDLMKNKKVWIGAAVVVIIFAWMLWSGQPAPVEAQ |
| Ga0209535_10122123 | 3300025120 | Marine | MKNLMKNKKVWIGAAVVVIVFAWMLWSGQPAPVEAQ |
| Ga0209535_10410563 | 3300025120 | Marine | MKDMMKNKKVWIGIAIVIAVAWFMWSGQPAPEVTQ |
| Ga0209535_11956602 | 3300025120 | Marine | MKNMMKNKKLWIGIAVVIAVAWFMWSGQPAPEVTQ |
| Ga0209348_10132253 | 3300025127 | Marine | MKAFLKSKKTWIAVAVVVVVFAWVLWSGQPAPEVTQ |
| Ga0208428_10194232 | 3300025653 | Aqueous | MKKFFKDKKVWIAIAVVVIAGAWFIWSGQPAPEVQG |
| Ga0208749_10550163 | 3300026077 | Marine | MKDLMKNKKVWIAVAVVVVVFAWAMMGGSPAPEVTQ |
| Ga0208405_10287432 | 3300026189 | Marine | MKHLKNKKLWIGVAIVVIVFAWAIWSGQPAPEVQG |
| Ga0209404_104244142 | 3300027906 | Marine | MKDLMKNKKVWIAVAVVVVVFAWAMMGGDPAPEVTQ |
| Ga0183748_10233197 | 3300029319 | Marine | MKDFLKNKKVWIGAAIVVIVIAWAVWSGQPAPEVAQ |
| Ga0183748_10968313 | 3300029319 | Marine | MKDFIKNKKVWIGAAIVIIVIGWAVWSGQPAPEVVQ |
| Ga0183755_10112001 | 3300029448 | Marine | MKDFIKNKKVWIGIAVVIIVIGWAVWSGQPAPEIQG |
| Ga0183755_10188802 | 3300029448 | Marine | MKAFLKSKKTWIAVAVVVIVFAYVLWTGQPAPEVTQ |
| ⦗Top⦘ |