


| Basic Information | |
|---|---|
| Family ID | F089026 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MNKKSYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK |
| Number of Associated Samples | 59 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 68.81 % |
| % of genes near scaffold ends (potentially truncated) | 26.61 % |
| % of genes from short scaffolds (< 2000 bps) | 74.31 % |
| Associated GOLD sequencing projects | 46 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.972 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (56.881 % of family members) |
| Environment Ontology (ENVO) | Unclassified (99.083 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.239 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01402 | RHH_1 | 1.83 |
| PF01507 | PAPS_reduct | 1.83 |
| PF14319 | Zn_Tnp_IS91 | 0.92 |
| PF00145 | DNA_methylase | 0.92 |
| PF00208 | ELFV_dehydrog | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.92 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.92 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.97 % |
| All Organisms | root | All Organisms | 33.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002484|JGI25129J35166_1009644 | Not Available | 2517 | Open in IMG/M |
| 3300002511|JGI25131J35506_1013998 | Not Available | 1103 | Open in IMG/M |
| 3300002511|JGI25131J35506_1058475 | Not Available | 536 | Open in IMG/M |
| 3300002514|JGI25133J35611_10012618 | All Organisms → cellular organisms → Archaea | 3604 | Open in IMG/M |
| 3300002514|JGI25133J35611_10099015 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 863 | Open in IMG/M |
| 3300002518|JGI25134J35505_10013949 | All Organisms → cellular organisms → Archaea | 2589 | Open in IMG/M |
| 3300002760|JGI25136J39404_1006799 | Not Available | 1988 | Open in IMG/M |
| 3300002760|JGI25136J39404_1011215 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 1593 | Open in IMG/M |
| 3300002760|JGI25136J39404_1082065 | Not Available | 604 | Open in IMG/M |
| 3300002760|JGI25136J39404_1098950 | Not Available | 549 | Open in IMG/M |
| 3300006324|Ga0068476_1356078 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 544 | Open in IMG/M |
| 3300006336|Ga0068502_1342678 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300006340|Ga0068503_10591525 | Not Available | 636 | Open in IMG/M |
| 3300006736|Ga0098033_1036177 | Not Available | 1479 | Open in IMG/M |
| 3300006736|Ga0098033_1067006 | Not Available | 1041 | Open in IMG/M |
| 3300006736|Ga0098033_1074047 | Not Available | 983 | Open in IMG/M |
| 3300006736|Ga0098033_1137033 | Not Available | 689 | Open in IMG/M |
| 3300006736|Ga0098033_1214916 | Not Available | 531 | Open in IMG/M |
| 3300006738|Ga0098035_1122879 | Not Available | 894 | Open in IMG/M |
| 3300006751|Ga0098040_1232665 | Not Available | 535 | Open in IMG/M |
| 3300006753|Ga0098039_1057052 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
| 3300006753|Ga0098039_1114484 | Not Available | 927 | Open in IMG/M |
| 3300006789|Ga0098054_1253460 | Not Available | 635 | Open in IMG/M |
| 3300006926|Ga0098057_1008164 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 2747 | Open in IMG/M |
| 3300006926|Ga0098057_1052532 | Not Available | 999 | Open in IMG/M |
| 3300006927|Ga0098034_1167800 | Not Available | 617 | Open in IMG/M |
| 3300008220|Ga0114910_1058789 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300009412|Ga0114903_1027063 | Not Available | 1441 | Open in IMG/M |
| 3300009414|Ga0114909_1066017 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 1039 | Open in IMG/M |
| 3300009414|Ga0114909_1070291 | Not Available | 998 | Open in IMG/M |
| 3300009418|Ga0114908_1088442 | Not Available | 1049 | Open in IMG/M |
| 3300009418|Ga0114908_1131003 | Not Available | 817 | Open in IMG/M |
| 3300009602|Ga0114900_1019738 | Not Available | 2467 | Open in IMG/M |
| 3300009602|Ga0114900_1039298 | Not Available | 1519 | Open in IMG/M |
| 3300009602|Ga0114900_1088460 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 867 | Open in IMG/M |
| 3300009613|Ga0105228_124491 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 559 | Open in IMG/M |
| 3300009620|Ga0114912_1032434 | Not Available | 1401 | Open in IMG/M |
| 3300009622|Ga0105173_1036737 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 794 | Open in IMG/M |
| 3300009622|Ga0105173_1099749 | Not Available | 533 | Open in IMG/M |
| 3300010155|Ga0098047_10018885 | All Organisms → cellular organisms → Archaea | 2772 | Open in IMG/M |
| 3300010155|Ga0098047_10111417 | Not Available | 1066 | Open in IMG/M |
| 3300010155|Ga0098047_10267931 | Not Available | 647 | Open in IMG/M |
| 3300017775|Ga0181432_1002487 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 4100 | Open in IMG/M |
| 3300017775|Ga0181432_1031385 | Not Available | 1425 | Open in IMG/M |
| 3300017775|Ga0181432_1107135 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 837 | Open in IMG/M |
| 3300017775|Ga0181432_1153170 | Not Available | 709 | Open in IMG/M |
| 3300020398|Ga0211637_10003313 | Not Available | 7597 | Open in IMG/M |
| 3300020407|Ga0211575_10445654 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 535 | Open in IMG/M |
| 3300021791|Ga0226832_10016037 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 2426 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10002992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10823 | Open in IMG/M |
| 3300025029|Ga0207900_112515 | Not Available | 716 | Open in IMG/M |
| 3300025045|Ga0207901_1020957 | Not Available | 895 | Open in IMG/M |
| 3300025050|Ga0207892_1024325 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 684 | Open in IMG/M |
| 3300025069|Ga0207887_1003297 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 2503 | Open in IMG/M |
| 3300025069|Ga0207887_1004114 | Not Available | 2240 | Open in IMG/M |
| 3300025069|Ga0207887_1008429 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300025069|Ga0207887_1043787 | Not Available | 728 | Open in IMG/M |
| 3300025078|Ga0208668_1067516 | Not Available | 645 | Open in IMG/M |
| 3300025082|Ga0208156_1078735 | Not Available | 618 | Open in IMG/M |
| 3300025097|Ga0208010_1034702 | Not Available | 1167 | Open in IMG/M |
| 3300025097|Ga0208010_1035318 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 1154 | Open in IMG/M |
| 3300025109|Ga0208553_1050353 | Not Available | 1031 | Open in IMG/M |
| 3300025112|Ga0209349_1001564 | All Organisms → cellular organisms → Archaea | 11297 | Open in IMG/M |
| 3300025112|Ga0209349_1006874 | Not Available | 4727 | Open in IMG/M |
| 3300025112|Ga0209349_1047003 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
| 3300025112|Ga0209349_1126083 | Not Available | 708 | Open in IMG/M |
| 3300025118|Ga0208790_1035121 | Not Available | 1640 | Open in IMG/M |
| 3300025122|Ga0209434_1048195 | Not Available | 1326 | Open in IMG/M |
| 3300025125|Ga0209644_1012574 | Not Available | 1781 | Open in IMG/M |
| 3300025125|Ga0209644_1024842 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300025125|Ga0209644_1030548 | Not Available | 1199 | Open in IMG/M |
| 3300025125|Ga0209644_1080679 | Not Available | 762 | Open in IMG/M |
| 3300025125|Ga0209644_1099080 | Not Available | 689 | Open in IMG/M |
| 3300025125|Ga0209644_1108769 | Not Available | 657 | Open in IMG/M |
| 3300025125|Ga0209644_1119782 | Not Available | 626 | Open in IMG/M |
| 3300025125|Ga0209644_1129725 | Not Available | 601 | Open in IMG/M |
| 3300025125|Ga0209644_1174226 | Not Available | 512 | Open in IMG/M |
| 3300025131|Ga0209128_1002548 | All Organisms → cellular organisms → Archaea | 11770 | Open in IMG/M |
| 3300025141|Ga0209756_1006976 | Not Available | 8184 | Open in IMG/M |
| 3300025141|Ga0209756_1078097 | Not Available | 1495 | Open in IMG/M |
| 3300025141|Ga0209756_1309920 | Not Available | 553 | Open in IMG/M |
| 3300025251|Ga0208182_1001250 | Not Available | 12280 | Open in IMG/M |
| 3300025251|Ga0208182_1026231 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300025264|Ga0208029_1004717 | Not Available | 4451 | Open in IMG/M |
| 3300025267|Ga0208179_1119580 | Not Available | 500 | Open in IMG/M |
| 3300025270|Ga0208813_1009756 | Not Available | 2821 | Open in IMG/M |
| 3300025282|Ga0208030_1026653 | Not Available | 1835 | Open in IMG/M |
| 3300025286|Ga0208315_1093925 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 720 | Open in IMG/M |
| 3300025293|Ga0208934_1024796 | Not Available | 1197 | Open in IMG/M |
| 3300025296|Ga0208316_1001320 | Not Available | 15128 | Open in IMG/M |
| 3300025873|Ga0209757_10006672 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2986 | Open in IMG/M |
| 3300025873|Ga0209757_10039272 | All Organisms → cellular organisms → Archaea | 1370 | Open in IMG/M |
| 3300025873|Ga0209757_10136068 | Not Available | 765 | Open in IMG/M |
| 3300025873|Ga0209757_10136264 | Not Available | 765 | Open in IMG/M |
| 3300025873|Ga0209757_10272442 | Not Available | 538 | Open in IMG/M |
| 3300026103|Ga0208451_1013744 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 859 | Open in IMG/M |
| 3300031801|Ga0310121_10017169 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 5373 | Open in IMG/M |
| 3300031801|Ga0310121_10033855 | Not Available | 3561 | Open in IMG/M |
| 3300031801|Ga0310121_10041248 | All Organisms → cellular organisms → Archaea | 3160 | Open in IMG/M |
| 3300031801|Ga0310121_10077367 | Not Available | 2173 | Open in IMG/M |
| 3300031801|Ga0310121_10215776 | Not Available | 1160 | Open in IMG/M |
| 3300031801|Ga0310121_10369627 | Not Available | 822 | Open in IMG/M |
| 3300031802|Ga0310123_10438817 | Not Available | 833 | Open in IMG/M |
| 3300031803|Ga0310120_10023072 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 3798 | Open in IMG/M |
| 3300031803|Ga0310120_10416382 | Not Available | 686 | Open in IMG/M |
| 3300032278|Ga0310345_10004141 | Not Available | 13324 | Open in IMG/M |
| 3300032820|Ga0310342_100023083 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 4825 | Open in IMG/M |
| 3300032820|Ga0310342_103427463 | Not Available | 524 | Open in IMG/M |
| 3300034656|Ga0326748_050919 | Not Available | 584 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 56.88% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 17.43% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.26% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 3.67% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.67% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.75% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.75% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.92% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.92% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009613 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3737_250 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020398 | Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072) | Environmental | Open in IMG/M |
| 3300020407 | Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115) | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025029 | Marine viral communities from the Pacific Ocean - LP-39 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25129J35166_10096443 | 3300002484 | Marine | LKHKTPYTIIKNRFITEFIEKYSDDSNRHFIQVMKKWRDLEK* |
| JGI25131J35506_10139984 | 3300002511 | Marine | MTKYKTIKNRFITEFIEKYSDDSNRQFIKILKQWRDLEK* |
| JGI25131J35506_10584751 | 3300002511 | Marine | MTKYKTIKNRFITEFIPKYSDKSDRHFIQVLKKWRDLEK* |
| JGI25133J35611_100126187 | 3300002514 | Marine | MTMPKKSYKDRCITEFNEYSDKSIRHFIQVMKQWRDLKK* |
| JGI25133J35611_100990153 | 3300002514 | Marine | MTRIKRSYKDRSITEFNEYSDESIRHFIQVKKQWKDLEK* |
| JGI25134J35505_100139493 | 3300002518 | Marine | MKIKSYKIIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK* |
| JGI25136J39404_10067997 | 3300002760 | Marine | MTKYKTIKNRFITEFIEKYSDDSNRHFIQVMKKWRDLEK* |
| JGI25136J39404_10112154 | 3300002760 | Marine | MTRPTRSYKDRSITEFNEYSDKSIRHFIQVKKQWRDLEK* |
| JGI25136J39404_10820653 | 3300002760 | Marine | MTRIKRSYKDRSITEFNEYSDKSIRHFIQVKKQWKDLEK* |
| JGI25136J39404_10989501 | 3300002760 | Marine | MTRIKRSYKDRYITEFNEYSDDSNRHFIQVLKKWRDLEK*NLKKY |
| Ga0068476_13560781 | 3300006324 | Marine | MTRPYKTIKNRFITEFIEKYSDDSNRHFIQVIKQWRD |
| Ga0068502_13426781 | 3300006336 | Marine | MTKYKTIKNRFITEFIPKYSDDSNRHFIQVLKKWRDLEK* |
| Ga0068503_105915251 | 3300006340 | Marine | ETSRWFLMTRIKRSYKDRSITEFNEYSDKSIRHFIQVLKKWRDLEK* |
| Ga0098033_10361775 | 3300006736 | Marine | MNKKSYKTIKNRFITEFIPKYSDESDRHFIQVLKKWRDLEK* |
| Ga0098033_10670062 | 3300006736 | Marine | MKIKKSYKDRCITEFNEYSDQSKRHFIQVLKKWRDLQK* |
| Ga0098033_10740473 | 3300006736 | Marine | MKIKKSYKNRCITEFIKKYSDQSDRQFFQVLKKWRD |
| Ga0098033_11370332 | 3300006736 | Marine | LKHKTPYTIIKNRFITEFIEKYSDDSNRHFIQVLKKWRTLKNE* |
| Ga0098033_12149162 | 3300006736 | Marine | MTKYKTIKNRCITEWIPKYSDDSNRQFIQVLKQWRDLEK* |
| Ga0098035_11228792 | 3300006738 | Marine | MPKKSYKDRCITEFNEYSDKSIRHFIQVMKQWRDLKK* |
| Ga0098040_12326651 | 3300006751 | Marine | SYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRNLQK* |
| Ga0098039_10570523 | 3300006753 | Marine | MTRIKRSYKDRSITEFNEYSDESNRHFIQVKKQWRDLEK* |
| Ga0098039_11144844 | 3300006753 | Marine | MTKYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK* |
| Ga0098054_12534602 | 3300006789 | Marine | LKHKTPYTIIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK*SVWI |
| Ga0098057_10081641 | 3300006926 | Marine | MKIKKSYKDRCITEFNEYSDQSKRHFIQVLKKWRDL |
| Ga0098057_10525321 | 3300006926 | Marine | LKHKTPYTIIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK* |
| Ga0098034_11678001 | 3300006927 | Marine | MTRIKKSYKNRCITEFNEYSDESKRHFIQVLKKWRDLEK* |
| Ga0114910_10587895 | 3300008220 | Deep Ocean | MIKSYKIIKNRFITEFIEKYSDDSNRHFIQVLKQWRDLEK* |
| Ga0114903_10270636 | 3300009412 | Deep Ocean | MTKYKTIKNRFITEFIEKYSDDSDRHFIKVMKQWRDLEK* |
| Ga0114909_10660173 | 3300009414 | Deep Ocean | MTKYKTIKNRFISEFIEKYSDDSNRHFIQVLKKWRDLEK* |
| Ga0114909_10702914 | 3300009414 | Deep Ocean | MTRIKRSYKDRSITEFNEYSDKSIRHFIQVKKQWR |
| Ga0114908_10884421 | 3300009418 | Deep Ocean | TRPKRSYKDRYITEFNEYSDDSNRHFIQVLKQWRDLEK* |
| Ga0114908_11310033 | 3300009418 | Deep Ocean | MTRPYKTIKNRFITEFIPKYSDDSNRHFIQVLKKWRDLEK*N |
| Ga0114900_10197385 | 3300009602 | Deep Ocean | MTRPYKTIKNRFITEFIPKYSDDSNRHFIQVLKKWRDLEK* |
| Ga0114900_10392981 | 3300009602 | Deep Ocean | MMIKSYKIIKNRFITEFIEKYSDDSNRHFIQVLKQWRDLEK* |
| Ga0114900_10884601 | 3300009602 | Deep Ocean | MTRKRSYKDRSITEFNEYSDKSIRHFIQVKKQWRDLEK* |
| Ga0105228_1244912 | 3300009613 | Marine Oceanic | MTRIKTVYKNHFITEFIEKYSDDSNRHFIQVLKKWRDLEK* |
| Ga0114912_10324344 | 3300009620 | Deep Ocean | MIKSYKIIKNRFITEFIEKYSDDSNRQFIQVLKKWRDLEK* |
| Ga0105173_10367371 | 3300009622 | Marine Oceanic | MTKYKTIKNRFITEFIEKYSDKSNRHFIQVLKKLRDLEK* |
| Ga0105173_10997492 | 3300009622 | Marine Oceanic | IGIGEKMTRIKRSYKDRSITEFNEYSDQSIRHFIQVMKQWRTLKNEM* |
| Ga0098047_100188855 | 3300010155 | Marine | MNKKSYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRTLKND* |
| Ga0098047_101114172 | 3300010155 | Marine | MKIKTAYKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK* |
| Ga0098047_102679311 | 3300010155 | Marine | HKTPYTIIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK* |
| Ga0181432_10024877 | 3300017775 | Seawater | MTRPKRSYKDRCITEFNEYSDKSIRHFIQVKKQWRDLEK |
| Ga0181432_10313851 | 3300017775 | Seawater | KMTKYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK |
| Ga0181432_11071354 | 3300017775 | Seawater | MTPKRSYKDRSITEFNEYSDESKRHFIQVLKQWRDLEK |
| Ga0181432_11531703 | 3300017775 | Seawater | MKIKKSYKNRCITEFNEYSDESKRHFIHVLKKWRDLEK |
| Ga0211637_1000331316 | 3300020398 | Marine | MTKYKTIKNRFITEFIEKYSDYSNRHFIQVMKQWRDFEK |
| Ga0211575_104456541 | 3300020407 | Marine | MTRKRSYKDRFITEFIEKYSDKSDRHFIQVMKQWRDLEK |
| Ga0226832_100160372 | 3300021791 | Hydrothermal Vent Fluids | MTRIKTAYKNHFITEFIEKYSDDSNRQFIQVLKQWRDLEK |
| (restricted) Ga0255047_1000299222 | 3300024520 | Seawater | MTRPTRSYKDRSITEFNEYSDESIRHFIQVKKQWRTLKND |
| Ga0207900_1125153 | 3300025029 | Marine | MTKYKTIKNRFITEFIEKYSDDSNRHFIQVLKQWRDLEK |
| Ga0207901_10209572 | 3300025045 | Marine | MKIKKSYKNRCITEFIPKYSDQSDRQFFQVLKKWRDLEK |
| Ga0207892_10243252 | 3300025050 | Marine | MTRPYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK |
| Ga0207887_10032974 | 3300025069 | Marine | MTRIKTAYKNHFITEFIEKYSDDSNRHFIQVLKQWRDLEK |
| Ga0207887_10041147 | 3300025069 | Marine | MEQVIMTIKRSYKDRSITEFNEYSDKSIRHFIQVLKQWRDLEK |
| Ga0207887_10084292 | 3300025069 | Marine | MMIKSYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDKEEKE |
| Ga0207887_10437872 | 3300025069 | Marine | MIKSYKTIKNRFITEFIEKYSDDSNRQFIQVLKKWRDLEK |
| Ga0208668_10675161 | 3300025078 | Marine | KTPYTIIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK |
| Ga0208156_10787353 | 3300025082 | Marine | YKTIKNHFITEFIEKYSDDSKRHFIQVLKKWRDLEK |
| Ga0208010_10347021 | 3300025097 | Marine | LKHKTPYTIIKNRFITEFIEKYSDDSNRHFIQVLKK |
| Ga0208010_10353182 | 3300025097 | Marine | MKIKKSYKDRCITEFNEYSDQSKRHFIQVLKKWRDLQK |
| Ga0208553_10503535 | 3300025109 | Marine | MNKKSYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK |
| Ga0209349_100156418 | 3300025112 | Marine | MTMPKKSYKDRCITEFNEYSDKSIRHFIQVMKQWRDLKK |
| Ga0209349_100687414 | 3300025112 | Marine | MIKRSYKDRSITEFNEYSDESIRHFIQVLKQWRDLEK |
| Ga0209349_10470034 | 3300025112 | Marine | MTRIKRSYKDRSITEFNEYSDESIRHFIQVKKQWKDLEK |
| Ga0209349_11260831 | 3300025112 | Marine | MTRIKRSYKDRSITEFNEYSDESIRHFIQVKKQWRD |
| Ga0208790_10351216 | 3300025118 | Marine | YKMTRPKRSYKDRSITEFNEYSDKSIRHFIQVLKKWRDLEK |
| Ga0209434_10481951 | 3300025122 | Marine | MTRKRSYKDRSITEFNEYSDKSIRHFIQVLKQWRDLEK |
| Ga0209644_10125747 | 3300025125 | Marine | MTRPYKTIKNRFITEFIPKYSDDSNRHFIQVLKKWRDLEK |
| Ga0209644_10248422 | 3300025125 | Marine | MTRIKTAYKNHFITEFIEKYSDKSIRHFIQVMKQWRDLEK |
| Ga0209644_10305485 | 3300025125 | Marine | MTTYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK |
| Ga0209644_10806793 | 3300025125 | Marine | MTKYKTIKNRFITEFIEKYSDDSNRHFIQVMKKWRDLEK |
| Ga0209644_10990804 | 3300025125 | Marine | FLMTRIKRSYKDRSITEFNEYSDKSIRHFIQVKKQWKDLEK |
| Ga0209644_11087691 | 3300025125 | Marine | MTKYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDL |
| Ga0209644_11197821 | 3300025125 | Marine | MTKYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEKXMNKKKT |
| Ga0209644_11297251 | 3300025125 | Marine | MKIKTAYKNHFITEFIKKYSDQSDRQFFQVLKKWRDLEK |
| Ga0209644_11742262 | 3300025125 | Marine | MKIKKSYKNRCITEFNEYSDESKRHFIQVLKQWRDLEK |
| Ga0209128_100254811 | 3300025131 | Marine | MKIKSYKIIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK |
| Ga0209756_100697615 | 3300025141 | Marine | MIKRSYKDRSITEFNEYSDESNRQFIQVKKQWRELKK |
| Ga0209756_10780973 | 3300025141 | Marine | MKRSYKDRSITEFNEYSDESNRHFIQVKKQWRDLEK |
| Ga0209756_13099202 | 3300025141 | Marine | MKIKTAYKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEKX |
| Ga0208182_10012507 | 3300025251 | Deep Ocean | MKRSYKDRSITEFNEYSDESIRHFIQVLKQWRDLEK |
| Ga0208182_10262313 | 3300025251 | Deep Ocean | MMIKSYKIIKNRFITEFIEKYSDDSNRHFIQVLKQWRDLEK |
| Ga0208029_100471712 | 3300025264 | Deep Ocean | MTRPKRSYKDRYITEFNEYSDKSIRHFIHVKKQWRDLEK |
| Ga0208179_11195801 | 3300025267 | Deep Ocean | IKRSYKDRSITEFNEYSDKSIRHFIQVKKQWRDLEK |
| Ga0208813_10097564 | 3300025270 | Deep Ocean | MMIKRSYKNRFITEFIPKYSDESDRHFIQVLKKWRDLEK |
| Ga0208030_10266536 | 3300025282 | Deep Ocean | MTRIKRSYKDRSITKFNEYSDKSKRHFIQVKKQWRDLEK |
| Ga0208315_10939253 | 3300025286 | Deep Ocean | MTRKRSYKDRSITEFNEYSDKSIRHFIQVKKQWRDLEK |
| Ga0208934_10247963 | 3300025293 | Deep Ocean | MTKYKTIKNRFITEFIEKYSDDSDRHFIKVMKQWRDLEK |
| Ga0208316_100132017 | 3300025296 | Deep Ocean | MKRSYKDRSITEFNEYSDESIRHFIQVLKKWRDLEK |
| Ga0209757_100066721 | 3300025873 | Marine | MTRIKTSYKNRCITEFIKKYSDKSNRHIIQVLKQW |
| Ga0209757_100392721 | 3300025873 | Marine | MIKRSYKNRFITEFIKKYSDKSNRHFIQVLKQWRN |
| Ga0209757_101360684 | 3300025873 | Marine | MTKYKTIKNRFITEFIEKYSDESIRHFIQVKKQWRDLEK |
| Ga0209757_101362643 | 3300025873 | Marine | MTKYKTIKNRFITEFIEKYSDYSNRHFIQVLKKWRDLEK |
| Ga0209757_102724422 | 3300025873 | Marine | MTRIKRSYKDRSITEFNEYSDKSIRHFIQVKKQWKDLEK |
| Ga0208451_10137442 | 3300026103 | Marine Oceanic | MTKYKTIKNRFITEFIEKYSDKSNRHFIQVLKKLRDLEK |
| Ga0310121_100171691 | 3300031801 | Marine | MTKYKTIKNHFITEFIEKYSDPSNRHFIQVMKKWR |
| Ga0310121_1003385510 | 3300031801 | Marine | MKIKKSYKNRCITEFIEKYSDQSDRQFFQVLKKWRDLEK |
| Ga0310121_100412485 | 3300031801 | Marine | MKIKTSYKNRCITEFNEYSDQSDRQFFQVLKKWRDLEK |
| Ga0310121_100773673 | 3300031801 | Marine | MKIKSYKTIKNHFITEFIEKYSDPSNRHFIQVLKKWRDLEK |
| Ga0310121_102157762 | 3300031801 | Marine | MKIKSYKTIKNRFITEFIEKYSDKSDRHFIQVLKKWRDLEK |
| Ga0310121_103696274 | 3300031801 | Marine | TRPYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEK |
| Ga0310123_104388172 | 3300031802 | Marine | MKIKTSYKNRFITEFNEYSDQSDRQFFQVLKKWRDLEK |
| Ga0310120_100230728 | 3300031803 | Marine | MTRIKRSYKNRSITEFNEYSDKSIRHFIQVLKQWRDLEK |
| Ga0310120_104163822 | 3300031803 | Marine | MTKYKTIKNRFITEFIEKYSDPSNRHFIQVLKKWRDLEK |
| Ga0310345_1000414119 | 3300032278 | Seawater | MTSKRSYKNRFITEFIEKYSDKSDRHFIQVKKQWRDLEK |
| Ga0310342_1000230836 | 3300032820 | Seawater | MTRKRSYKDRFITEFIEKYSDKSDRHFIQVKKQWRDLEK |
| Ga0310342_1034274633 | 3300032820 | Seawater | MTKYKTIKNRFITEFIEKYSDDSNRHFIQVLKKWRDLEKXPKKYTN |
| Ga0326748_050919_296_439 | 3300034656 | Filtered Seawater | MTKYKTIKNRFITEFIQKYSDDSNRHFIQVLKKWRDLEKWKNDYSLI |
| ⦗Top⦘ |