


| Basic Information | |
|---|---|
| Family ID | F088987 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 47 residues |
| Representative Sequence | KRDYRDVLFWAEYPEEARLDTPEKRERVRKMFEKFGIKPPDDL |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.50 % |
| % of genes near scaffold ends (potentially truncated) | 89.91 % |
| % of genes from short scaffolds (< 2000 bps) | 84.40 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.661 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (30.275 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.706 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.798 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01384 | PHO4 | 54.13 |
| PF01769 | MgtE | 12.84 |
| PF01865 | PhoU_div | 6.42 |
| PF13714 | PEP_mutase | 6.42 |
| PF02566 | OsmC | 4.59 |
| PF01797 | Y1_Tnp | 2.75 |
| PF03448 | MgtE_N | 2.75 |
| PF07883 | Cupin_2 | 1.83 |
| PF00326 | Peptidase_S9 | 1.83 |
| PF00550 | PP-binding | 0.92 |
| PF13302 | Acetyltransf_3 | 0.92 |
| PF00378 | ECH_1 | 0.92 |
| PF03483 | B3_4 | 0.92 |
| PF00702 | Hydrolase | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 54.13 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 15.60 |
| COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 12.84 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 6.42 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 4.59 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 4.59 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.66 % |
| Unclassified | root | N/A | 7.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005174|Ga0066680_10361651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 925 | Open in IMG/M |
| 3300005175|Ga0066673_10672674 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005177|Ga0066690_10085344 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 2004 | Open in IMG/M |
| 3300005178|Ga0066688_10770843 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300005180|Ga0066685_11042998 | Not Available | 538 | Open in IMG/M |
| 3300005181|Ga0066678_10419561 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 888 | Open in IMG/M |
| 3300005184|Ga0066671_10392349 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 887 | Open in IMG/M |
| 3300005184|Ga0066671_11045548 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
| 3300005187|Ga0066675_11036706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 615 | Open in IMG/M |
| 3300005354|Ga0070675_100392147 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005546|Ga0070696_100951813 | Not Available | 715 | Open in IMG/M |
| 3300005552|Ga0066701_10690828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 614 | Open in IMG/M |
| 3300005555|Ga0066692_10620739 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 677 | Open in IMG/M |
| 3300005561|Ga0066699_11001989 | Not Available | 579 | Open in IMG/M |
| 3300005568|Ga0066703_10334816 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 911 | Open in IMG/M |
| 3300005576|Ga0066708_10696734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
| 3300005587|Ga0066654_10085429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium | 1490 | Open in IMG/M |
| 3300005587|Ga0066654_10199713 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1038 | Open in IMG/M |
| 3300005842|Ga0068858_100132018 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
| 3300006031|Ga0066651_10551916 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 611 | Open in IMG/M |
| 3300006034|Ga0066656_10386587 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300006046|Ga0066652_100714839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 954 | Open in IMG/M |
| 3300006059|Ga0075017_100485937 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300006354|Ga0075021_11011226 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300006791|Ga0066653_10022200 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
| 3300006791|Ga0066653_10307334 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 799 | Open in IMG/M |
| 3300006796|Ga0066665_10462029 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1046 | Open in IMG/M |
| 3300006796|Ga0066665_10566370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 921 | Open in IMG/M |
| 3300006800|Ga0066660_11560540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300006804|Ga0079221_10156209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1200 | Open in IMG/M |
| 3300006854|Ga0075425_100493615 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300006871|Ga0075434_100198283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2027 | Open in IMG/M |
| 3300007258|Ga0099793_10601655 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 551 | Open in IMG/M |
| 3300009012|Ga0066710_100301711 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
| 3300009012|Ga0066710_104411556 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 3300009038|Ga0099829_10050439 | All Organisms → cellular organisms → Bacteria | 3081 | Open in IMG/M |
| 3300009088|Ga0099830_10103154 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300009137|Ga0066709_100529504 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1665 | Open in IMG/M |
| 3300009162|Ga0075423_10709063 | Not Available | 1062 | Open in IMG/M |
| 3300010301|Ga0134070_10019417 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300010304|Ga0134088_10209871 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300010325|Ga0134064_10161517 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 781 | Open in IMG/M |
| 3300010326|Ga0134065_10014544 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2145 | Open in IMG/M |
| 3300010335|Ga0134063_10062822 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1641 | Open in IMG/M |
| 3300010373|Ga0134128_10655770 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1166 | Open in IMG/M |
| 3300010396|Ga0134126_12965239 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010399|Ga0134127_11342800 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300012096|Ga0137389_10117942 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2134 | Open in IMG/M |
| 3300012198|Ga0137364_10314969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1163 | Open in IMG/M |
| 3300012198|Ga0137364_11055494 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 613 | Open in IMG/M |
| 3300012199|Ga0137383_10363083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1061 | Open in IMG/M |
| 3300012203|Ga0137399_10160591 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1802 | Open in IMG/M |
| 3300012203|Ga0137399_10369903 | Not Available | 1193 | Open in IMG/M |
| 3300012205|Ga0137362_11470783 | Not Available | 568 | Open in IMG/M |
| 3300012205|Ga0137362_11574585 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012207|Ga0137381_10778578 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 830 | Open in IMG/M |
| 3300012207|Ga0137381_11800153 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012208|Ga0137376_10048334 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3468 | Open in IMG/M |
| 3300012208|Ga0137376_10612629 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300012208|Ga0137376_11135001 | Not Available | 668 | Open in IMG/M |
| 3300012209|Ga0137379_10402417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1278 | Open in IMG/M |
| 3300012285|Ga0137370_10858264 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
| 3300012285|Ga0137370_11022482 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300012349|Ga0137387_10392677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1006 | Open in IMG/M |
| 3300012356|Ga0137371_10856453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 691 | Open in IMG/M |
| 3300012363|Ga0137390_10180071 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300012582|Ga0137358_10083099 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2158 | Open in IMG/M |
| 3300012918|Ga0137396_11222863 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
| 3300012972|Ga0134077_10019708 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300012977|Ga0134087_10317118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 735 | Open in IMG/M |
| 3300014157|Ga0134078_10030509 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1768 | Open in IMG/M |
| 3300015264|Ga0137403_10003961 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 17570 | Open in IMG/M |
| 3300017654|Ga0134069_1342707 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300017657|Ga0134074_1340708 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
| 3300018433|Ga0066667_10275894 | Not Available | 1291 | Open in IMG/M |
| 3300018433|Ga0066667_11939602 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
| 3300018468|Ga0066662_10257267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1432 | Open in IMG/M |
| 3300018482|Ga0066669_11054073 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 734 | Open in IMG/M |
| 3300025910|Ga0207684_10832345 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 779 | Open in IMG/M |
| 3300025910|Ga0207684_10944344 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 723 | Open in IMG/M |
| 3300025926|Ga0207659_10506016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1023 | Open in IMG/M |
| 3300025972|Ga0207668_10490151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1055 | Open in IMG/M |
| 3300026305|Ga0209688_1083064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 581 | Open in IMG/M |
| 3300026312|Ga0209153_1100985 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300026312|Ga0209153_1196346 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 713 | Open in IMG/M |
| 3300026315|Ga0209686_1061262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1354 | Open in IMG/M |
| 3300026325|Ga0209152_10123990 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 983 | Open in IMG/M |
| 3300026330|Ga0209473_1009043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5014 | Open in IMG/M |
| 3300026331|Ga0209267_1122067 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1097 | Open in IMG/M |
| 3300026342|Ga0209057_1127690 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 926 | Open in IMG/M |
| 3300026351|Ga0257170_1007377 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1317 | Open in IMG/M |
| 3300026354|Ga0257180_1002102 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1837 | Open in IMG/M |
| 3300026369|Ga0257152_1038567 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026514|Ga0257168_1141398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300026529|Ga0209806_1055609 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1840 | Open in IMG/M |
| 3300026530|Ga0209807_1153133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 877 | Open in IMG/M |
| 3300026550|Ga0209474_10324647 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 885 | Open in IMG/M |
| 3300026551|Ga0209648_10508270 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300026551|Ga0209648_10738046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300027727|Ga0209328_10062378 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1142 | Open in IMG/M |
| 3300027882|Ga0209590_10009141 | All Organisms → cellular organisms → Bacteria | 4546 | Open in IMG/M |
| 3300027899|Ga0209668_10247182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. OV335 | 1128 | Open in IMG/M |
| 3300030848|Ga0075388_10015326 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300030966|Ga0075383_11333570 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1084 | Open in IMG/M |
| 3300031057|Ga0170834_106545686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300031231|Ga0170824_108632342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter ambystomatis | 907 | Open in IMG/M |
| 3300031753|Ga0307477_10165669 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300031820|Ga0307473_10709838 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031962|Ga0307479_11013314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 799 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 30.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030966 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066680_103616512 | 3300005174 | Soil | YRDVLFWAEYPEEARLGTPEKRERIKKMFEKFGIKPPEDL* |
| Ga0066673_106726741 | 3300005175 | Soil | EEKLREFVAVAKRDYRDVLFWADYPEEASLDTPEKRQRIRNMFEKFGIKPPNDL* |
| Ga0066690_100853441 | 3300005177 | Soil | EEKLREFLAVAKRDYRDVLFWAEYPEESRLDTPEKKERIKKMFEKFGIKPPEGL* |
| Ga0066688_107708432 | 3300005178 | Soil | AKRDYRDVLFWAEYPEESRLDTPERSERIRKMFKKFGIEPPKNL* |
| Ga0066685_110429981 | 3300005180 | Soil | KLRQYVGVAKRDYRDVLFWAEYPEEAKIDTPEKRRKVRELFEKLGLEPPASLLE* |
| Ga0066678_104195612 | 3300005181 | Soil | YRDVLFWAEYPEESRLDTPEKKERIKKMFEKFGIKPPEGF* |
| Ga0066671_103923491 | 3300005184 | Soil | EFVAVAKRDYRDVLFWAENPEEAKLDTPEKRERIKKMFEKFGIKPPESEPDWH* |
| Ga0066671_110455482 | 3300005184 | Soil | EEKLREFVAVAKRDYRDVLFWAENPEEARLDTPEKRERIRKMFQKFGIKPPEDL* |
| Ga0066675_110367062 | 3300005187 | Soil | KLREFVAVAKRDYRDVIFWAENPEEAKLDTPEKRERIKKMLEKFGINPPENL* |
| Ga0070675_1003921471 | 3300005354 | Miscanthus Rhizosphere | KDEEKLREFTSVAKIDYRDVLFWAEHPEEAKADTPEKRQKVRAMLEKLGLPPPADLLE* |
| Ga0070696_1009518132 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | YRDVLFWAEYPEESKVDTPEKRRQVRELFEKLGLEPPASLLE* |
| Ga0066701_106908281 | 3300005552 | Soil | LREFLAVAKRDYRDVLFWAEYPKESRLDTPEKRARVRKMFEKFGIKPPDDL* |
| Ga0066692_106207391 | 3300005555 | Soil | DVLFWAEYPEESRLDTPERKERIKKMFEKFGIKPPDDW* |
| Ga0066699_110019892 | 3300005561 | Soil | GKEEKLRQYAGVAKRDYRDVLFWAEYPEEAKIDTPEKRRQVRELFEKLGLEPPASLLE* |
| Ga0066703_103348162 | 3300005568 | Soil | YRDVLFWAEYPEESRLDTPEKRARVRKMFEKFGIKPPDDL* |
| Ga0066708_106967341 | 3300005576 | Soil | EFVAVAKRDYRDVLFWAENPEEARLDTPEKRARVRKMFEKFGIKPPDDL* |
| Ga0066654_100854293 | 3300005587 | Soil | AKRDYRDVLFWAEYPEESRLDTEEKRRRVRKMFEKFGIEPPSDL* |
| Ga0066654_101997131 | 3300005587 | Soil | DYRDVLFWAEYPEESRLDTPEKRARVRKMFEKFGIKPPDDL* |
| Ga0068858_1001320187 | 3300005842 | Switchgrass Rhizosphere | VAKIDYRDVLFWAEHPEEAKADTPEKRQKVRAMLEKLGLPPPADLLE* |
| Ga0066651_105519162 | 3300006031 | Soil | AKRDYRDVLFWADNPEEAKLDASEKRERIRKMFEQFGTKPPDAL* |
| Ga0066656_103865871 | 3300006034 | Soil | AGSEAKVREYVAVAKRDYRDVLFWAEYPEESRLDTPEKRKRVRKMFEKFGIKPPSDL* |
| Ga0066652_1007148391 | 3300006046 | Soil | EEKLREFVAVAKRDDRDVLFWAENPEEARLDTPEKRERVRKMFEKFGVKPPERF* |
| Ga0075017_1004859373 | 3300006059 | Watersheds | EKLRELVAIAKRDYRDVLFCAEYPEQAKLDTPQKRERIKKMFAQFGIKPPENL* |
| Ga0075021_110112261 | 3300006354 | Watersheds | EFVAVAKRDYRDVILWAEYPEESRLDTPEKRERVRKMFRQFGIKPPEGF* |
| Ga0066653_100222004 | 3300006791 | Soil | GAGSEAKVREYVAVAKRDYRDVLFWAEYPEESRLDTPGRSERIRKMFKKFGIEPPKNL* |
| Ga0066653_103073342 | 3300006791 | Soil | FWAEYPEESKLDTPEKRQRVRKMFEKFGIEPPSDL* |
| Ga0066665_104620292 | 3300006796 | Soil | VAKRDYRDVLFWAEYPEESKLDTPEKRQRVRKMFEKFGIEPPSDL* |
| Ga0066665_105663701 | 3300006796 | Soil | YRDVLFWAEYPEEARLDTPERSERIRKTFKKFGIEPPKNL* |
| Ga0066660_115605401 | 3300006800 | Soil | RDYRDVLFWAENPDEARLDTPEKRERIRKMFEKFGIKPPDDL* |
| Ga0079221_101562091 | 3300006804 | Agricultural Soil | DGSEEKLREFVAVAKHDYRDVLFWAANREESKLDTPDKREQIKNRIGKMFDKFGIKSPEAL* |
| Ga0075425_1004936152 | 3300006854 | Populus Rhizosphere | VTRTRRELIAVAKRDYRDVLFWAEYPEESRLDAPEKRRRMRELLEKLGIEPPSALKE* |
| Ga0075434_1001982835 | 3300006871 | Populus Rhizosphere | VTRTRREVIAVAKRDYRDVLFWAEYPEESRLDAPEKRRRMRELLEKLGIEPPSALKE* |
| Ga0099793_106016551 | 3300007258 | Vadose Zone Soil | VLFWAEHPDEARLDTPEKRERVRKMFEKFGIKPPEGF* |
| Ga0066710_1003017111 | 3300009012 | Grasslands Soil | KRDYRDVLFWAEYPEESRLDTPEKRQRMRKMLEKFGIEPPRDL |
| Ga0066710_1044115562 | 3300009012 | Grasslands Soil | EGNEGKLGEFVAVAKRDYRDVLFWAENPAEAKLDTPEKRERIKKMFEKFGIKPPDDL |
| Ga0099829_100504391 | 3300009038 | Vadose Zone Soil | KLRDLVAVAKRDYRDVLFWAENPEEARLDTPEKRERVRKMFEKFGIKPPDDL* |
| Ga0099830_101031543 | 3300009088 | Vadose Zone Soil | VLFWAENPEEARLDTPEKRERVRKMFEKFGIKPPDDL* |
| Ga0066709_1005295042 | 3300009137 | Grasslands Soil | VAKRDYRDVLFWAENPEEARLDTPEKRARVRKMFEKFGIKPPDDL* |
| Ga0075423_107090631 | 3300009162 | Populus Rhizosphere | RDVLFWAEYPEEAKIDTPEKRRQVRELFERLGLEPPASLLE* |
| Ga0134070_100194174 | 3300010301 | Grasslands Soil | VLFWAEYPEETRMDTPERIERVRKIFEKFGIEPPRDL* |
| Ga0134088_102098712 | 3300010304 | Grasslands Soil | GSEEKLCEFVAVAKRDYRDVLFWVEYPEESRLDTPEKRQRVRKMFEKFGIKPPENL* |
| Ga0134064_101615171 | 3300010325 | Grasslands Soil | LFWAEYPEESRLDAPERSERVRKIFEKFGIEPPRDL* |
| Ga0134065_100145441 | 3300010326 | Grasslands Soil | KRDYRDVLFWAENPDEARLDTPEKRERVRKMFEKFGIKPPEGF* |
| Ga0134063_100628223 | 3300010335 | Grasslands Soil | YVAVAKRDDRDVLFWAEYPEESRMDTPERIGRVRKIFEKFGIEPPKDL* |
| Ga0134128_106557701 | 3300010373 | Terrestrial Soil | RDYRDVLFWADNPEEARLDTPEKRERLKKMFEQFRIKPPENL* |
| Ga0134126_129652391 | 3300010396 | Terrestrial Soil | DYRDVLFWAEYPEESRLDTPEKRQRVRKMFEKFGIEPPSDL* |
| Ga0134127_113428002 | 3300010399 | Terrestrial Soil | TLSEKDEGKLREFTSVAKIDYRDVLFWAEHPEEAKADTPEKRQKVRAMLEKLGLPPPADLLE* |
| Ga0137389_101179421 | 3300012096 | Vadose Zone Soil | KLREFVAVAKRDYRDVLFWAEYPEESRLDTPEKKARIKKMFEKFGIKPPDDL* |
| Ga0137364_103149692 | 3300012198 | Vadose Zone Soil | REYVAVAKRDYRDVLFWAEYPEETRLDTPEKSERIRKMFKKFGIEPPKNL* |
| Ga0137364_110554941 | 3300012198 | Vadose Zone Soil | KVREYVAVAKRDYRDVLFWAEYPEESRLDTPEKRERVRKMFEKFGIEPPSDL* |
| Ga0137383_103630831 | 3300012199 | Vadose Zone Soil | VAVAKRDYRDVLFWAEYPEESRLDTPEKREKLRKMFENFGIEPPSDL* |
| Ga0137399_101605913 | 3300012203 | Vadose Zone Soil | VLFWAENPEEAKLDTPEKRERVKKMFEKFGIKPPDDL* |
| Ga0137399_103699032 | 3300012203 | Vadose Zone Soil | VLFRAEYPEESRIDTPEKRQKVRELFEELGIDPPPSLLE* |
| Ga0137362_114707831 | 3300012205 | Vadose Zone Soil | EKLRQYVGVAKRDYRDVLFWAEYPEEAKIDTPEKRRKVRELFEKLGLEPPASLLE* |
| Ga0137362_115745852 | 3300012205 | Vadose Zone Soil | VAKRDYRDVLFWAECPEESRLDTPEKRQRVRKMFEKFGIKPPDDL* |
| Ga0137381_107785782 | 3300012207 | Vadose Zone Soil | DYRDVLFWAEYPEESRLDTPEKREKVRKMFENFGIEPPSDL* |
| Ga0137381_118001532 | 3300012207 | Vadose Zone Soil | DVLFWAEYPEESRLDTPEKRERIKKMFEKFGIKQPDDL* |
| Ga0137376_100483344 | 3300012208 | Vadose Zone Soil | RDVLFWAEYPEESRLDTPGRSERIREMFKKFGIEPPKNL* |
| Ga0137376_106126292 | 3300012208 | Vadose Zone Soil | VLFWAEYPEESRIDTPEKRQKVRELFEELGIDPPPSLLE* |
| Ga0137376_111350011 | 3300012208 | Vadose Zone Soil | YVGVAKRDFRDVLFWAEYPEEAKIDTPEKRRQVRELFEKLGLEPPPSLLE* |
| Ga0137379_104024172 | 3300012209 | Vadose Zone Soil | EEKVREYVAAAKRDYRDVLFWAEYPEESRLDTPEKRQRVRTMFEKFGIEPPDDL* |
| Ga0137370_108582642 | 3300012285 | Vadose Zone Soil | GAASEAKVREYVAVAKRDYRDVLFWAEYPEESRLNTPERSERVRKIFEKFGIEPPRDL* |
| Ga0137370_110224823 | 3300012285 | Vadose Zone Soil | FVAVAKRDYRDVLFWAENPDEAKLDTPEKHERIKKMFEKFGIKPSDNL* |
| Ga0137387_103926772 | 3300012349 | Vadose Zone Soil | WAEYPEESRLGTPERIERVRKMLEKFGIEPPKEL* |
| Ga0137371_108564532 | 3300012356 | Vadose Zone Soil | KRDYRDVLFWAEYPEESRLDTPEKREKLRKMFENFGIEPPSDL* |
| Ga0137390_101800713 | 3300012363 | Vadose Zone Soil | VLFWAENPKEARLDTPEKRERVRKMFEKFGIKPPDDL* |
| Ga0137358_100830991 | 3300012582 | Vadose Zone Soil | EEKLREFVAVAKRDYRDVLFWAEHPDEARLDTPEKRERVRKMFEKFGIKPPEGF* |
| Ga0137396_112228631 | 3300012918 | Vadose Zone Soil | KLREFVAVAKRDYRDVLFWAENPEEARLDTPEKKERIKKMFEKFGIKPPDAL* |
| Ga0134077_100197081 | 3300012972 | Grasslands Soil | RDYRDVLFWAEYPEESRLDTPEKRQRVRKMFEKFGIEPPSDL* |
| Ga0134087_103171181 | 3300012977 | Grasslands Soil | KLREYVAVAKRDYRDVLFWAEYPEESRLNTPEGSERVRKMFEKFGIEPPKDL* |
| Ga0134078_100305093 | 3300014157 | Grasslands Soil | GAGSEAKVREYVAVAKRDYRDVLFWAEYPEESRLDTPERSERIRKMFKKFGIEPPKNL* |
| Ga0137403_1000396111 | 3300015264 | Vadose Zone Soil | XEEKLREFVAVAKRDYRDVLFWAEHPDEARLDTPEKRERVRKMFEKFGIKPPEGF* |
| Ga0134069_13427071 | 3300017654 | Grasslands Soil | VLFWAEYPEESTLDTPEKRQRMRKMLEKFGIEPPRDL |
| Ga0134074_13407081 | 3300017657 | Grasslands Soil | VAAAKRDYRDVLFWAEYPEESRLDTPEKRQRVRTMFEKFGIEPPDDL |
| Ga0066667_102758942 | 3300018433 | Grasslands Soil | LFWAEYPEEAKIDTPEKRRQVRELFEKLGLEPPPSLLE |
| Ga0066667_119396021 | 3300018433 | Grasslands Soil | KRDYRNVLFWAEYPEESRLDTPAKRQRVRNMFEKFGIEPPSDL |
| Ga0066662_102572673 | 3300018468 | Grasslands Soil | DYRDVLFWAEYPEETRMDTPERIERVRKIFEKFGIEPPRDL |
| Ga0066669_110540731 | 3300018482 | Grasslands Soil | DVLFWAENPEEARLDTPEKRERVRKMFEKFGVKPPERF |
| Ga0207684_108323451 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KHDYRDVLFWAEYPEESKLDTPEKRQRVRKMFEKFGIEPPSDL |
| Ga0207684_109443442 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | NEEKLREFFAVAKRDYRDVLFWAEYPEEARLDTPEKRERVRKMFEKFGITPPDDL |
| Ga0207659_105060161 | 3300025926 | Miscanthus Rhizosphere | AVAKIDYRDVLFWAEHPEEAKADTPEKRQKVRAMLEKLGLPPPADLLE |
| Ga0207668_104901511 | 3300025972 | Switchgrass Rhizosphere | LREFTSVAKIDYRDVLFWAEHPEEAKADTPEKRQKVRAMLEKLGLPPPADLLE |
| Ga0209688_10830641 | 3300026305 | Soil | MREYVAVAKRDYRDVLFWAEYPEESRLDTGEKRQRARKIFEKFGIEPPSDL |
| Ga0209153_11009853 | 3300026312 | Soil | KLREFIAAAKRDYRDVLFWAENPEESRLDTPEKKERIKKMFEKFGIKPPDDF |
| Ga0209153_11963461 | 3300026312 | Soil | LFWAENPEEARLDTPEKRERIKKMFEKFGIKPPESEPDWH |
| Ga0209686_10612621 | 3300026315 | Soil | VAKRDYRDVLFWAENPEEARLDTPEKRARVRKMFEKFGIKPPDDL |
| Ga0209152_101239901 | 3300026325 | Soil | LGEFVAVAKRDYRDVLFWAEYPEEARLDTPEKRERVKKMFEKFGIKPPDDL |
| Ga0209473_10090435 | 3300026330 | Soil | RNVLFWAEYPEESRLDTPAKRQRVRNMFEKFGIEPPSDL |
| Ga0209267_11220671 | 3300026331 | Soil | KRDYRDVLFWAEYPEESRLDTPEKRARVRKMFEKFGIKPPDDL |
| Ga0209057_11276902 | 3300026342 | Soil | KEEKVREYVAVAKRDYRDVLFWAEYPEESRLDTPEKRQRVRKMFEKFGIEPPSDL |
| Ga0257170_10073772 | 3300026351 | Soil | YRDVLFWSENPDEARLDTPEKRERVRKMFEKFGIKPPDDL |
| Ga0257180_10021023 | 3300026354 | Soil | AVAKRDYRDVLFWAENPEEARLDTPEKRERVRKMFEKFGIKPPDDL |
| Ga0257152_10385673 | 3300026369 | Soil | DVLFWAEYPEESKLDTPEKRQRVRKMFEKFGIEPPSDL |
| Ga0257168_11413982 | 3300026514 | Soil | SGESEEKLREFVAVAKRDYRDVLFWAENPEEARLDTPEKRERVRKMFKKFGIKPPDAL |
| Ga0209806_10556091 | 3300026529 | Soil | FWAEYPEESRLDTPEKREKLRKMFENFGIEPSSDL |
| Ga0209807_11531332 | 3300026530 | Soil | LREFVAVAKRDYRDVLFWAENPEEARLDTPEKRARVRKMFEKFGIKPPDDL |
| Ga0209474_103246471 | 3300026550 | Soil | MTVAKRDYRDVLFWAEYPEESKLDTPEKRQRVRKMFEKFGIEPPSDL |
| Ga0209648_105082702 | 3300026551 | Grasslands Soil | DYRDVLFWAAYPKEARLDTPEKKERIKKMFEQFGIKPPDDL |
| Ga0209648_107380462 | 3300026551 | Grasslands Soil | KRDYRDVLFWAEYPEEARLDTPEKRERVRKMFEKFGIKPPDDL |
| Ga0209328_100623782 | 3300027727 | Forest Soil | YVAVAKRDYRDVLFWAEYPEESRLDTPEKRERVRKMFEKFGIKPPDDL |
| Ga0209590_100091413 | 3300027882 | Vadose Zone Soil | VLFWAENPEEARLDTPEKRERVRKMFEKFGIKPPDDL |
| Ga0209668_102471822 | 3300027899 | Freshwater Lake Sediment | AVAKRDYRDVLFFAEFPDEAKVDTPEKRRELRELFEKLGLNPPPGPLE |
| Ga0075388_100153261 | 3300030848 | Soil | AVAKRDYRDVLFWAEYPEESKLDRPEKRQRVRKMFEKFGIEPLSDL |
| Ga0075383_113335701 | 3300030966 | Soil | VAVAKRDYRDVLFWAEYPEESKLDRPEKRQRVRKMFEKFGIEPLSDL |
| Ga0170834_1065456861 | 3300031057 | Forest Soil | SEAKVREYVAVAKRDYRDVLFWAEYPEESKLDRPEKRQRVRKMFEKFGIEPPSDL |
| Ga0170824_1086323421 | 3300031231 | Forest Soil | DYRDVLFWAEYPEESKLDTPEKRQRVRKMFEKFGIEPPSDL |
| Ga0307477_101656692 | 3300031753 | Hardwood Forest Soil | EYVVVAKRDYRDVLFWAEYPEESRLGTPEKRLRVRKMFERFGIKPEDI |
| Ga0307473_107098381 | 3300031820 | Hardwood Forest Soil | VLFWAENPDEARLDTPEKRERVRKMFEKFGIKPPEGF |
| Ga0307479_110133141 | 3300031962 | Hardwood Forest Soil | MNNFNTEIRGEGEYVAVAKRDYRDALFWAEYPEESRLDTTEKRERVRKMFEKFGI |
| ⦗Top⦘ |