


| Basic Information | |
|---|---|
| Family ID | F088961 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GRVGVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAVALRS |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.48 % |
| % of genes near scaffold ends (potentially truncated) | 86.24 % |
| % of genes from short scaffolds (< 2000 bps) | 85.32 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.394 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.183 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.688 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.450 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 0.00% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF13701 | DDE_Tnp_1_4 | 4.59 |
| PF01695 | IstB_IS21 | 1.83 |
| PF00665 | rve | 0.92 |
| PF13620 | CarboxypepD_reg | 0.92 |
| PF08388 | GIIM | 0.92 |
| PF14559 | TPR_19 | 0.92 |
| PF11295 | DUF3096 | 0.92 |
| PF13189 | Cytidylate_kin2 | 0.92 |
| PF04932 | Wzy_C | 0.92 |
| PF07224 | Chlorophyllase | 0.92 |
| PF01590 | GAF | 0.92 |
| PF02782 | FGGY_C | 0.92 |
| PF07995 | GSDH | 0.92 |
| PF01904 | DUF72 | 0.92 |
| PF01610 | DDE_Tnp_ISL3 | 0.92 |
| PF13242 | Hydrolase_like | 0.92 |
| PF02687 | FtsX | 0.92 |
| PF04366 | Ysc84 | 0.92 |
| PF01425 | Amidase | 0.92 |
| PF14690 | zf-ISL3 | 0.92 |
| PF00873 | ACR_tran | 0.92 |
| PF05016 | ParE_toxin | 0.92 |
| PF00583 | Acetyltransf_1 | 0.92 |
| PF12390 | Se-cys_synth_N | 0.92 |
| PF13545 | HTH_Crp_2 | 0.92 |
| PF00805 | Pentapeptide | 0.92 |
| PF00027 | cNMP_binding | 0.92 |
| PF13565 | HTH_32 | 0.92 |
| PF07364 | DUF1485 | 0.92 |
| PF11149 | DUF2924 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 1.83 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.92 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.92 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.92 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.92 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.92 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.92 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.92 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.39 % |
| Unclassified | root | N/A | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M101EKD15 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300004091|Ga0062387_101500017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300004973|Ga0072322_1206104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300005187|Ga0066675_11338133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300005436|Ga0070713_101274172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300005446|Ga0066686_10494188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300005450|Ga0066682_10789120 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005552|Ga0066701_10221547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1165 | Open in IMG/M |
| 3300005764|Ga0066903_106848649 | Not Available | 592 | Open in IMG/M |
| 3300006358|Ga0068871_101142363 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 729 | Open in IMG/M |
| 3300006893|Ga0073928_10881993 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009038|Ga0099829_11726088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 514 | Open in IMG/M |
| 3300009089|Ga0099828_11412552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300009137|Ga0066709_104565437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300009524|Ga0116225_1059361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1823 | Open in IMG/M |
| 3300009548|Ga0116107_1088530 | Not Available | 944 | Open in IMG/M |
| 3300009641|Ga0116120_1278300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300009643|Ga0116110_1229153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300009662|Ga0105856_1302288 | Not Available | 535 | Open in IMG/M |
| 3300009672|Ga0116215_1331693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300010303|Ga0134082_10121341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300010339|Ga0074046_10039325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3185 | Open in IMG/M |
| 3300010341|Ga0074045_10093974 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300010359|Ga0126376_11144569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300010361|Ga0126378_12607669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300010366|Ga0126379_10786431 | Not Available | 1050 | Open in IMG/M |
| 3300010366|Ga0126379_13365779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300010376|Ga0126381_102676566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300010376|Ga0126381_105007939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300011271|Ga0137393_10982727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300012157|Ga0137353_1088520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Melittangium → Melittangium boletus → Melittangium boletus DSM 14713 | 577 | Open in IMG/M |
| 3300012189|Ga0137388_11396873 | Not Available | 639 | Open in IMG/M |
| 3300012199|Ga0137383_10229852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1359 | Open in IMG/M |
| 3300012199|Ga0137383_10310761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1154 | Open in IMG/M |
| 3300012199|Ga0137383_11022735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300012202|Ga0137363_10456104 | Not Available | 1070 | Open in IMG/M |
| 3300012205|Ga0137362_11041480 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012357|Ga0137384_10103606 | Not Available | 2375 | Open in IMG/M |
| 3300012359|Ga0137385_10989973 | Not Available | 694 | Open in IMG/M |
| 3300012362|Ga0137361_11537084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300012363|Ga0137390_10299532 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300012469|Ga0150984_103872313 | Not Available | 666 | Open in IMG/M |
| 3300012918|Ga0137396_10192124 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300012925|Ga0137419_11065059 | Not Available | 672 | Open in IMG/M |
| 3300012927|Ga0137416_10554118 | Not Available | 996 | Open in IMG/M |
| 3300012930|Ga0137407_11945515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300012939|Ga0162650_100060418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300013297|Ga0157378_11300046 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300014150|Ga0134081_10408288 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300014162|Ga0181538_10461443 | Not Available | 672 | Open in IMG/M |
| 3300014164|Ga0181532_10081143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2056 | Open in IMG/M |
| 3300014495|Ga0182015_10095144 | Not Available | 2074 | Open in IMG/M |
| 3300014495|Ga0182015_10671441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300014501|Ga0182024_11872394 | Not Available | 668 | Open in IMG/M |
| 3300014638|Ga0181536_10381913 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae | 634 | Open in IMG/M |
| 3300014638|Ga0181536_10409098 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300016270|Ga0182036_11580067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 552 | Open in IMG/M |
| 3300016294|Ga0182041_10151558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1790 | Open in IMG/M |
| 3300016294|Ga0182041_12076319 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300016371|Ga0182034_11297596 | Not Available | 635 | Open in IMG/M |
| 3300016371|Ga0182034_11422111 | Not Available | 606 | Open in IMG/M |
| 3300016387|Ga0182040_11545385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300016404|Ga0182037_11877514 | Not Available | 536 | Open in IMG/M |
| 3300016750|Ga0181505_10437505 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300017928|Ga0187806_1222025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300017938|Ga0187854_10081006 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300017938|Ga0187854_10307611 | Not Available | 676 | Open in IMG/M |
| 3300017955|Ga0187817_11003752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → unclassified Syntrophomonadaceae → Syntrophomonadaceae bacterium | 535 | Open in IMG/M |
| 3300018012|Ga0187810_10407060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300018012|Ga0187810_10516215 | Not Available | 511 | Open in IMG/M |
| 3300018016|Ga0187880_1407125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300018022|Ga0187864_10434926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300018040|Ga0187862_10070316 | All Organisms → cellular organisms → Bacteria → PVC group | 2488 | Open in IMG/M |
| 3300018057|Ga0187858_10367578 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300018482|Ga0066669_10215515 | Not Available | 1485 | Open in IMG/M |
| 3300019082|Ga0187852_1022993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus tenax | 3094 | Open in IMG/M |
| 3300019082|Ga0187852_1204304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300020199|Ga0179592_10337910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300020603|Ga0194126_10411104 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300021168|Ga0210406_11382770 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300021478|Ga0210402_10880290 | Not Available | 822 | Open in IMG/M |
| 3300021560|Ga0126371_10231863 | Not Available | 1954 | Open in IMG/M |
| 3300021560|Ga0126371_12064349 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300021560|Ga0126371_12401111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium → unclassified Rhizomicrobium → Rhizomicrobium sp. SCGC AG-212-E05 | 638 | Open in IMG/M |
| 3300022711|Ga0242674_1045208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300025928|Ga0207700_10704193 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300025936|Ga0207670_11421237 | Not Available | 589 | Open in IMG/M |
| 3300026557|Ga0179587_10151597 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300027879|Ga0209169_10207884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
| 3300027910|Ga0209583_10019714 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300028536|Ga0137415_10116933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2513 | Open in IMG/M |
| 3300028536|Ga0137415_10192964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1858 | Open in IMG/M |
| 3300030707|Ga0310038_10185086 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300031057|Ga0170834_110077034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300031576|Ga0247727_10113453 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
| 3300031716|Ga0310813_11466774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300031753|Ga0307477_10376660 | Not Available | 974 | Open in IMG/M |
| 3300031768|Ga0318509_10134641 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300031770|Ga0318521_11029085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300031771|Ga0318546_11285351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300031941|Ga0310912_10787246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300032180|Ga0307471_102319734 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300032783|Ga0335079_11552037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300033402|Ga0326728_10171914 | Not Available | 2272 | Open in IMG/M |
| 3300033419|Ga0316601_100047115 | All Organisms → cellular organisms → Bacteria | 3160 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.18% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.83% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.92% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.92% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.92% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.92% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004973 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_04138660 | 2189573001 | Grass Soil | FLFLAAKIWSHAGRVGVSYSDHYEEKGIFQRLMDRLRTISDGVNGFAPVISRALRS |
| Ga0062387_1015000171 | 3300004091 | Bog Forest Soil | GVSYSDHYEEKGIFQRLMDRLRTISDAAKGFAPVISRALRC* |
| Ga0072322_12061043 | 3300004973 | Peatlands Soil | SYSDHYAEQGIFQRLMQRLRAIAVGPKGYLPVLAVALRF* |
| Ga0066675_113381332 | 3300005187 | Soil | HGGRVGVSYSDHYAEQGIFQRLMQRLRAIALGPHGYVSVVAVALRS* |
| Ga0070713_1012741722 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVSYSDHYEEKGVFRRLLDRLRAIVLDGKRFGPVLATPLTG* |
| Ga0066686_104941882 | 3300005446 | Soil | GVSYSDHYEERGIFQRLMDRLRAIAACGPRFGPVVAAALT* |
| Ga0066682_107891201 | 3300005450 | Soil | GRVGVSYSDHYAEQGIQRLMQRLRAIAVGPKGYVAVVAVALRS* |
| Ga0066701_102215472 | 3300005552 | Soil | VGVSYSDHYPEQGIFQRLMDRLRAITVGKKGFVPVLTEPLRC* |
| Ga0066903_1068486491 | 3300005764 | Tropical Forest Soil | SYSDHYAEQGIFRRLMDRLRAIAADGPNFVPVLPTALTG* |
| Ga0068871_1011423632 | 3300006358 | Miscanthus Rhizosphere | SYSDHYEEKGIFGRLLDRLRAIAPDGQRFGPVLAMPLTG* |
| Ga0073928_108819932 | 3300006893 | Iron-Sulfur Acid Spring | IWRHAGRVGVSYSDHYQEKGIFGRLLDRLRAIAPDGQRFGPVLATPLTG* |
| Ga0099829_117260881 | 3300009038 | Vadose Zone Soil | DHYEERGIFQRLMDRLRAIAACGPRFGPVVAAALT* |
| Ga0099828_114125522 | 3300009089 | Vadose Zone Soil | VGVSYSDHYPERGLFQRLMDRLRAITVGEKGFVPVLALALRC* |
| Ga0066709_1045654372 | 3300009137 | Grasslands Soil | TGVSYSDHYEERGIFQRLMDRLRAIAACGPRFGPVVAAALT* |
| Ga0116225_10593611 | 3300009524 | Peatlands Soil | SDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAAALRF* |
| Ga0116107_10885301 | 3300009548 | Peatland | HYAEQGIFQRLMQRLRAIAVGPKGYAPVLAVALRS* |
| Ga0116120_12783001 | 3300009641 | Peatland | GRVGVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAVALRS* |
| Ga0116110_12291532 | 3300009643 | Peatland | VGVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAAALRY* |
| Ga0105856_13022882 | 3300009662 | Permafrost Soil | GVSYSDHYAEQGIFRRLMDRLRSITPDGPRFGPVLATPLTG* |
| Ga0116215_13316931 | 3300009672 | Peatlands Soil | DHYAEQGIFQRLMQRLRAIAVGPKGYLPVLAVALRF* |
| Ga0134082_101213413 | 3300010303 | Grasslands Soil | LFLAAKIWSHGGRVGVSYSDHYEEKGIFQRLMDRLRSITDGANGFAPVVPTALRC* |
| Ga0074046_100393251 | 3300010339 | Bog Forest Soil | GRVGVSYSDHYEEKGIFQRLMDRLRTITDGANGFAPVISRALRC* |
| Ga0074045_100939741 | 3300010341 | Bog Forest Soil | SDHYEEKGIFQRLMDRLRTITDGANGFAPVISRALRC* |
| Ga0126376_111445692 | 3300010359 | Tropical Forest Soil | AGRVGVSYSDHYTEQGLFQRLMDRLRAIALDGQRFRPVLATVLRE* |
| Ga0126378_126076691 | 3300010361 | Tropical Forest Soil | WRHAGRVGVSYSDHYAEQGIFRRLMDRLRGIAADGRRFVPVLAAPLTC* |
| Ga0126379_107864311 | 3300010366 | Tropical Forest Soil | SYSDHYAEQGIFQRLMDRLQAITREGPRFRPVLATALRE* |
| Ga0126379_133657791 | 3300010366 | Tropical Forest Soil | RHAGRVGVSYSDHYAEQGLFRRLMDRLRAIATDGPRFRPVLANPLTG* |
| Ga0126381_1026765662 | 3300010376 | Tropical Forest Soil | GRVGVSYSDHYAEQGIFRRLMDRLWAITSEGPPFRPVLAMALLE* |
| Ga0126381_1050079391 | 3300010376 | Tropical Forest Soil | GGRVGLSYSDHYAEPGLFQRLMKRLRGIRCGEKGYAPVLAVALCC* |
| Ga0137393_109827272 | 3300011271 | Vadose Zone Soil | VGVSYSDHYPERGIFQRLMDRLTAITVGEKGFVPVLTLALRC* |
| Ga0137353_10885202 | 3300012157 | Soil | GVSYSDHYAEQGIFRRLMDRLRSIATDGQRFGPVVATALTG* |
| Ga0137388_113968731 | 3300012189 | Vadose Zone Soil | YEEKGIFQRLMERLRAITDDDSRFAHVVLSALCC* |
| Ga0137383_102298521 | 3300012199 | Vadose Zone Soil | SDHYEEKGIFQRLMDRLRSITDGANKFAPVVPTALRC* |
| Ga0137383_103107612 | 3300012199 | Vadose Zone Soil | DHYEEKGIFQRLMDRLRSITDGANKFAPVVPTALRC* |
| Ga0137383_110227351 | 3300012199 | Vadose Zone Soil | DTGAGWGVSYSDHYAERGIFQRLMERLRAITVSEKGYVQVLAVALRS* |
| Ga0137363_104561042 | 3300012202 | Vadose Zone Soil | YSDHYAEQGIFRRLMERLRMIASDGPRFAPVLATALTG* |
| Ga0137362_110414802 | 3300012205 | Vadose Zone Soil | SDHYEEKGIFQRLMDRLRAISKDGNGFAPVVPLALRC* |
| Ga0137384_101036062 | 3300012357 | Vadose Zone Soil | VSYSDHYAERGIFQRLMERLRAITVSEKGYVQVLAVALRS* |
| Ga0137385_109899732 | 3300012359 | Vadose Zone Soil | DHYAEQGIFQRLMNRLRRIVEGPQGFVPVIAVALRV* |
| Ga0137361_115370841 | 3300012362 | Vadose Zone Soil | HAGRVGVSYSDHYPERGIFQRLMDRLRAITVGEKGFVPVLALALRC* |
| Ga0137390_102995324 | 3300012363 | Vadose Zone Soil | FLAAKIWCHGGRVGVSYSDHYEEKGIFQRLMDRLRAITKGDNGFAPVVPLALRC* |
| Ga0150984_1038723133 | 3300012469 | Avena Fatua Rhizosphere | VSYSDHYEEKGIFCRLLGRLRAIAQDAVGPFGPVLAMPLTG* |
| Ga0137396_101921241 | 3300012918 | Vadose Zone Soil | AGRVGVSYSDHYAERGLFQRLMERLRSIAPGETNLRPVFATALRS* |
| Ga0137419_104941072 | 3300012925 | Vadose Zone Soil | LFLAAKIWSHAGRVGISYSDHYEEKGIFQRLMDRLRTITDGANGFAPVISRALRC* |
| Ga0137419_110650591 | 3300012925 | Vadose Zone Soil | GVSYSDHYPEKGFCSEMDRLRAITVGEKGFAPVLALRC* |
| Ga0137416_105541181 | 3300012927 | Vadose Zone Soil | DHYEEKGIFQRLMERLRAITHDGSRFAPVVLSALRC* |
| Ga0137407_119455151 | 3300012930 | Vadose Zone Soil | GRVGVSYSDHYEEKGIFHRLMDRLRAITKDDNGFAPVVPLALRC* |
| Ga0162650_1000604181 | 3300012939 | Soil | RHAGRVGVSYSDHYPEQGIVQRLMNRLRAITVSKKGFVPVLAAPLRC* |
| Ga0134110_103013581 | 3300012975 | Grasslands Soil | LRFLFLAAKIWSHGGRVGVSYSDHYEEKGIFQRLMDRLRSITDGANGFAPVVPTALRC* |
| (restricted) Ga0172364_100670173 | 3300013129 | Sediment | VGDSYSDHYEEKGIFDRLMGRLRAIRPDGGSFTPVLETALRR* |
| Ga0157378_113000461 | 3300013297 | Miscanthus Rhizosphere | RVGVSYSDHYEERGIFSRLLNRLRTIAPDGQRFGPVLATPLTG* |
| Ga0134081_104082882 | 3300014150 | Grasslands Soil | RHGGRVGVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYVAVVAVALRS* |
| Ga0181538_104614432 | 3300014162 | Bog | MLMAVSYSDHYAEQGILQRLMQRLRAIAVGPKGYAPVLAVALRS* |
| Ga0181532_100811431 | 3300014164 | Bog | SHSGRVGVSYSDHYEEKGIFQRLMDRLRTITDGANGFAPVISRALRC* |
| Ga0182015_100951441 | 3300014495 | Palsa | MGRVGVSYSDHYAEKGILERLMNRLRAIVEGPKGFAPVIAS |
| Ga0182015_106714411 | 3300014495 | Palsa | YSDHYQEKGIFQRLMDRLRLITDGVNGFAPVVPTALRC* |
| Ga0182024_118723941 | 3300014501 | Permafrost | GRVGVSYSDHYAEQGIFRRLMDRLRAITTDGQRFGPVLATALTG* |
| Ga0182021_131948541 | 3300014502 | Fen | DHYEEKAIFDRLMRRVRAIAAGADGFTPVIATALRC* |
| Ga0181536_103819131 | 3300014638 | Bog | VGISYSDHYAEQRVFRRLMERLRAIAVGSQGYVPVLSVALRC* |
| Ga0181536_104090981 | 3300014638 | Bog | DHYAEQGIFQRLMQRLRAIGVGPQGYVPVLAVALRS* |
| Ga0182036_115800671 | 3300016270 | Soil | SDHYAEQGIFRRLMDRLGAIAADGPNFVPVLPTALTG |
| Ga0182041_101515582 | 3300016294 | Soil | GGRVGVSYSDPYAEPGLFQRLAERLRGITRGEKGYAPVLAVALRC |
| Ga0182041_120763191 | 3300016294 | Soil | AGRVGVSYSDHYAERGLFQRLMDRLRAIAPGEMNFTPVLATPLRS |
| Ga0182034_112975961 | 3300016371 | Soil | IWRYAGTVGVSYSDHYAEQGFFPRLDRLRAITCERERFPPVLATALREWE |
| Ga0182034_114221112 | 3300016371 | Soil | VGVSYSDHYAEQGIFRRLMDRLRAIASAGQRFDPVLATPLRE |
| Ga0182040_115453852 | 3300016387 | Soil | GRVGVSYSDHYAEQGVFCRLMLPLRAIARDGQRFGPVLATALTG |
| Ga0182037_118775142 | 3300016404 | Soil | DHRRVGSEITVNYSDHYAEQGMFCRLMNRLRAITTDGPRFRPVLATPLTG |
| Ga0181505_104375051 | 3300016750 | Peatland | VSYSDHYAEQGIFRRLMDRLRAITTDGQRFGPVLATALTG |
| Ga0187806_12220251 | 3300017928 | Freshwater Sediment | GRVGVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAVALRF |
| Ga0187854_100810063 | 3300017938 | Peatland | RVGVSYSDHYQEKGTFQRLMDRLRAIAGGAHGFTPVVATALRC |
| Ga0187854_103076112 | 3300017938 | Peatland | MLMAVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAVALRS |
| Ga0187817_110037521 | 3300017955 | Freshwater Sediment | WRHGGRVGVSYSDHYAEQGIFQRLMQRLRAIAVGAEGYAPVLAVALRF |
| Ga0187810_104070601 | 3300018012 | Freshwater Sediment | VGVSYSDHYAERGIFQRLMERLRAIAVGPKGYLPVLGV |
| Ga0187810_105162151 | 3300018012 | Freshwater Sediment | SDHYAEKGIFQRLMQRLRAIAVGPKGYAPVLAAALRF |
| Ga0187880_14071251 | 3300018016 | Peatland | IWRHGGRVGVSYSDHYAEQGIFQRLMQRLRAIGVGPKGYVPVLAVALRS |
| Ga0187864_104349261 | 3300018022 | Peatland | LRFLFLAAKIWCHAGRVGVSYSDHYEEKGIFQRLMDRLRSITDGVNGFAPVVPTALRC |
| Ga0187862_100703163 | 3300018040 | Peatland | LMAVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAVALRS |
| Ga0187858_103675782 | 3300018057 | Peatland | VGVSYSDHYAEQGIFQRLMQRLRAIGVGPKGYVPVLAVALRS |
| Ga0066669_102155151 | 3300018482 | Grasslands Soil | PTRLPFLFLAAKIWCYSGRVGVSYSDHYEEKGIFQRLMDRLRAITKEGNRFAPVVPLALR |
| Ga0187852_10229933 | 3300019082 | Peatland | MLMAVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAVDLRS |
| Ga0187852_12043042 | 3300019082 | Peatland | WVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLAVALRF |
| Ga0179592_103379101 | 3300020199 | Vadose Zone Soil | RFLFLSAKIWCHSGRVGVSYSDHYEEKGIFQRLMDRLRTIKKDDNGFVPVVPQALRC |
| Ga0194126_104111042 | 3300020603 | Freshwater Lake | VRYSDHYEEKGLFERLMNRLRSIAAGASGFPPVIATALRC |
| Ga0210406_113827701 | 3300021168 | Soil | VGVSYSDHYPERGIFQRFMDRLTAITVGEKGFVPVLALAL |
| Ga0210402_108802901 | 3300021478 | Soil | RHAGRVGVSYSDHYEEKGIFSRLLDRLRAIAPEGQRFGPVLITPLTG |
| Ga0126371_102318632 | 3300021560 | Tropical Forest Soil | VSYSDHYAEQGIFTRLMERLRAISFGERGFMPVIAVALRC |
| Ga0126371_120643491 | 3300021560 | Tropical Forest Soil | VGVSYSDHYPEQGIFQRLMDRLRAITVGERGFMPVLAVPL |
| Ga0126371_124011112 | 3300021560 | Tropical Forest Soil | IWRHAGRVGISYSDHYAEQGIFQRLMDRLRTITSEGPWFRPVLAVALRE |
| Ga0242674_10452082 | 3300022711 | Soil | WSHAGRVGVSYSDHYEEKGIFQRLMDRLRVITDGVNGFAPVISLALRS |
| Ga0207700_107041931 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RHAGRVGVSYSDHYEEKGVFRRLLDRLRAIVLDGKRFGPVLATPLTG |
| Ga0207670_114212371 | 3300025936 | Switchgrass Rhizosphere | VSYSNHYAEQGMFHRLMERLRMIASAGPRFAPVVATALSG |
| Ga0179587_101515972 | 3300026557 | Vadose Zone Soil | DHYEEQGIFGRLMHRLRGITIHGQRFGPVLATALTG |
| Ga0209169_102078841 | 3300027879 | Soil | DHYQEKSIFSRLLERLRAIAQNAVRPFGPVLATPLTG |
| Ga0209583_100197143 | 3300027910 | Watersheds | SYSDHYAEQGIFRRLMERLRMIAGDGQSFAPVLATPLTG |
| Ga0137415_101169333 | 3300028536 | Vadose Zone Soil | VSYSDHYEEKGIFQRLMDRLRTIKKNDNGFVPVVPQALRY |
| Ga0137415_101929641 | 3300028536 | Vadose Zone Soil | VSYSDHYEEKGIFQRLMDRLRTIKKDDNGFVPVVPQALRC |
| Ga0310038_101850861 | 3300030707 | Peatlands Soil | VGVSYRDHYAEQGIFQRLMQRLRAIAVGPKGYAPVLA |
| Ga0170834_1100770341 | 3300031057 | Forest Soil | GRVGVSYSDHYPERGIFQRLMDRLRAITVGEKGFVPVLALALRC |
| Ga0247727_101134532 | 3300031576 | Biofilm | MKRYAFPHSYSDHYPEKGIFQRLMERLRAITAGQEGFSPVVAVALTG |
| Ga0310813_114667742 | 3300031716 | Soil | LRFLFVAAKVWRHAGRVGVSYSDHYAEQGIFCRLMDRLRAIAIDGHRFRLVLATALTG |
| Ga0307477_103766601 | 3300031753 | Hardwood Forest Soil | VGVSYSDHYAEQGIFRRLMDRLRAIARQGQRFRPVLATALKE |
| Ga0318509_101346411 | 3300031768 | Soil | RRSDHYREQGIFRRLMDRLRAFASDGQRFGPVPATALRE |
| Ga0318521_110290852 | 3300031770 | Soil | RTVGVSYSDHYTEQGIFQRLMQRLRAIAVGPHGYVPVLAVALRS |
| Ga0318546_112853511 | 3300031771 | Soil | GRHGGRVGVSYSDPYAEPGLFQRLVERLRGITRGEKGYAPVLAVALRC |
| Ga0310912_107872461 | 3300031941 | Soil | HAGRVGISYSDHYAEQGMFRRLMDRLRAITSEGQRFRPVLATALRE |
| Ga0307471_1023197341 | 3300032180 | Hardwood Forest Soil | AAKIWCHSGRVGVSYSDHYEEKGIFQRLMDRLRAITKDDDGFAPVVPLALRC |
| Ga0335079_115520371 | 3300032783 | Soil | GGRVGVSYSDHYAEQGIFQRLMQRLRAIAVGPKGYGPVLGLALRC |
| Ga0326728_101719143 | 3300033402 | Peat Soil | NDDYAEQGILQRLMQRLRAIAVGPKGYVPVLVVAQRS |
| Ga0316601_1000471151 | 3300033419 | Soil | MEVSDHYQEQGIFQHLMDRLRAIVGGANGFRPVVATALRC |
| ⦗Top⦘ |