


| Basic Information | |
|---|---|
| Family ID | F088951 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCA |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.85 % |
| % of genes near scaffold ends (potentially truncated) | 82.57 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.394 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat (48.624 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.248 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.963 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.87% β-sheet: 0.00% Coil/Unstructured: 89.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13340 | DUF4096 | 5.77 |
| PF03441 | FAD_binding_7 | 2.88 |
| PF02698 | DUF218 | 1.92 |
| PF13360 | PQQ_2 | 1.92 |
| PF10049 | DUF2283 | 0.96 |
| PF00118 | Cpn60_TCP1 | 0.96 |
| PF00756 | Esterase | 0.96 |
| PF09860 | DUF2087 | 0.96 |
| PF00025 | Arf | 0.96 |
| PF13426 | PAS_9 | 0.96 |
| PF03683 | UPF0175 | 0.96 |
| PF13424 | TPR_12 | 0.96 |
| PF01740 | STAS | 0.96 |
| PF02355 | SecD_SecF | 0.96 |
| PF02896 | PEP-utilizers_C | 0.96 |
| PF00565 | SNase | 0.96 |
| PF00490 | ALAD | 0.96 |
| PF00300 | His_Phos_1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 2.88 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 0.96 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.96 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.96 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.96 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.39 % |
| Unclassified | root | N/A | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002493|JGI24185J35167_1011152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2953 | Open in IMG/M |
| 3300002493|JGI24185J35167_1012870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2638 | Open in IMG/M |
| 3300002510|JGI24186J35511_1009794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2137 | Open in IMG/M |
| 3300002510|JGI24186J35511_1009794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2137 | Open in IMG/M |
| 3300002510|JGI24186J35511_1036313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 742 | Open in IMG/M |
| 3300002510|JGI24186J35511_1039961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 682 | Open in IMG/M |
| 3300003688|Ga0061020_1038977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 1233 | Open in IMG/M |
| 3300003688|Ga0061020_1092052 | Not Available | 623 | Open in IMG/M |
| 3300005244|Ga0068644_1018552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 659 | Open in IMG/M |
| 3300005245|Ga0068640_121999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 527 | Open in IMG/M |
| 3300005245|Ga0068640_130195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 567 | Open in IMG/M |
| 3300005246|Ga0068638_124925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 762 | Open in IMG/M |
| 3300005247|Ga0068637_1030902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2372 | Open in IMG/M |
| 3300005248|Ga0068636_1032659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 640 | Open in IMG/M |
| 3300005248|Ga0068636_1032659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 640 | Open in IMG/M |
| 3300005248|Ga0068636_1080680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 580 | Open in IMG/M |
| 3300005249|Ga0068645_1116458 | Not Available | 720 | Open in IMG/M |
| 3300005250|Ga0068635_1050070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1657 | Open in IMG/M |
| 3300005250|Ga0068635_1109896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 813 | Open in IMG/M |
| 3300005250|Ga0068635_1109896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 813 | Open in IMG/M |
| 3300005251|Ga0068634_1128371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 930 | Open in IMG/M |
| 3300005388|Ga0068652_103754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 643 | Open in IMG/M |
| 3300005390|Ga0068657_107032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1185 | Open in IMG/M |
| 3300005390|Ga0068657_119951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1432 | Open in IMG/M |
| 3300005409|Ga0068651_1009529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 2323 | Open in IMG/M |
| 3300005411|Ga0068647_1040775 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Velamenicoccus → Candidatus Velamenicoccus archaeovorus | 508 | Open in IMG/M |
| 3300005452|Ga0068706_1061603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 670 | Open in IMG/M |
| 3300005453|Ga0068705_10139639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 609 | Open in IMG/M |
| 3300005480|Ga0068661_110977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 666 | Open in IMG/M |
| 3300005480|Ga0068661_110977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 666 | Open in IMG/M |
| 3300005486|Ga0068660_103141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 585 | Open in IMG/M |
| 3300005486|Ga0068660_115136 | Not Available | 531 | Open in IMG/M |
| 3300005486|Ga0068660_117584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 893 | Open in IMG/M |
| 3300005486|Ga0068660_121804 | Not Available | 538 | Open in IMG/M |
| 3300005490|Ga0068662_129263 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300005492|Ga0068665_111517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 528 | Open in IMG/M |
| 3300005492|Ga0068665_115281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 542 | Open in IMG/M |
| 3300005494|Ga0068668_1027824 | Not Available | 594 | Open in IMG/M |
| 3300005494|Ga0068668_1038336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 521 | Open in IMG/M |
| 3300005495|Ga0068666_1014888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 650 | Open in IMG/M |
| 3300005638|Ga0068669_1151081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 578 | Open in IMG/M |
| 3300006359|Ga0068676_1016272 | Not Available | 731 | Open in IMG/M |
| 3300006380|Ga0068664_1035492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 953 | Open in IMG/M |
| 3300006380|Ga0068664_1164538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 658 | Open in IMG/M |
| 3300006380|Ga0068664_1164538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 658 | Open in IMG/M |
| 3300006848|Ga0101768_1220697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 562 | Open in IMG/M |
| 3300007000|Ga0102499_1090240 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010176|Ga0124933_175194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 701 | Open in IMG/M |
| 3300010183|Ga0124919_1091728 | Not Available | 576 | Open in IMG/M |
| 3300010184|Ga0124920_1124679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 577 | Open in IMG/M |
| 3300010191|Ga0124914_1077357 | Not Available | 504 | Open in IMG/M |
| 3300010195|Ga0124911_1158521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 569 | Open in IMG/M |
| 3300010196|Ga0124923_1071843 | Not Available | 714 | Open in IMG/M |
| 3300020153|Ga0197142_1004282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 11603 | Open in IMG/M |
| 3300026293|Ga0209227_1082959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 974 | Open in IMG/M |
| 3300026509|Ga0209809_1140673 | Not Available | 553 | Open in IMG/M |
| 3300026509|Ga0209809_1156420 | Not Available | 504 | Open in IMG/M |
| 3300027279|Ga0209691_1028143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1251 | Open in IMG/M |
| 3300027279|Ga0209691_1055230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 748 | Open in IMG/M |
| 3300027515|Ga0209162_1146533 | Not Available | 579 | Open in IMG/M |
| 3300031245|Ga0308395_1078950 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300031245|Ga0308395_1147215 | Not Available | 506 | Open in IMG/M |
| 3300031508|Ga0308394_1053724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 930 | Open in IMG/M |
| 3300031509|Ga0308399_1007447 | Not Available | 3176 | Open in IMG/M |
| 3300031512|Ga0308397_1107766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 591 | Open in IMG/M |
| 3300031512|Ga0308397_1128399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 524 | Open in IMG/M |
| 3300031513|Ga0308412_1074793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1075 | Open in IMG/M |
| 3300031513|Ga0308412_1104572 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031513|Ga0308412_1106619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 832 | Open in IMG/M |
| 3300031513|Ga0308412_1171435 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031515|Ga0308396_1061519 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300031517|Ga0308392_1093184 | Not Available | 625 | Open in IMG/M |
| 3300031567|Ga0308391_1096459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 618 | Open in IMG/M |
| 3300031568|Ga0308393_1021714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1726 | Open in IMG/M |
| 3300031568|Ga0308393_1090137 | Not Available | 661 | Open in IMG/M |
| 3300031767|Ga0308401_1084065 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031776|Ga0308415_1083714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 671 | Open in IMG/M |
| 3300031783|Ga0308418_1121900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 556 | Open in IMG/M |
| 3300031783|Ga0308418_1128429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 537 | Open in IMG/M |
| 3300031812|Ga0308411_10217514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 638 | Open in IMG/M |
| 3300031812|Ga0308411_10278038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 542 | Open in IMG/M |
| 3300031812|Ga0308411_10304900 | Not Available | 510 | Open in IMG/M |
| 3300031865|Ga0308408_1047112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1065 | Open in IMG/M |
| 3300031865|Ga0308408_1057288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 935 | Open in IMG/M |
| 3300031865|Ga0308408_1079177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 752 | Open in IMG/M |
| 3300031865|Ga0308408_1146015 | Not Available | 501 | Open in IMG/M |
| 3300031875|Ga0308405_1160153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 510 | Open in IMG/M |
| 3300031878|Ga0308404_1047831 | Not Available | 873 | Open in IMG/M |
| 3300031878|Ga0308404_1085453 | Not Available | 618 | Open in IMG/M |
| 3300031948|Ga0308406_1081374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 677 | Open in IMG/M |
| 3300031950|Ga0308417_1073338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1302 | Open in IMG/M |
| 3300031950|Ga0308417_1176400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 682 | Open in IMG/M |
| 3300031950|Ga0308417_1189214 | Not Available | 649 | Open in IMG/M |
| 3300031950|Ga0308417_1233662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 560 | Open in IMG/M |
| 3300031950|Ga0308417_1261976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 517 | Open in IMG/M |
| 3300031966|Ga0308420_1061295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1324 | Open in IMG/M |
| 3300032034|Ga0308407_1067547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 773 | Open in IMG/M |
| 3300032049|Ga0308416_1072319 | Not Available | 655 | Open in IMG/M |
| 3300032058|Ga0308419_1194334 | Not Available | 500 | Open in IMG/M |
| 3300032356|Ga0308414_1088702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1126 | Open in IMG/M |
| 3300032356|Ga0308414_1121538 | Not Available | 874 | Open in IMG/M |
| 3300032356|Ga0308414_1172155 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300033886|Ga0308413_015144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2849 | Open in IMG/M |
| 3300033886|Ga0308413_072371 | Not Available | 914 | Open in IMG/M |
| 3300033886|Ga0308413_150945 | Not Available | 544 | Open in IMG/M |
| 3300033886|Ga0308413_154336 | Not Available | 536 | Open in IMG/M |
| 3300034647|Ga0372968_032156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 686 | Open in IMG/M |
| 3300034648|Ga0372970_047599 | Not Available | 607 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 48.62% |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 44.04% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 6.42% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002493 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 | Environmental | Open in IMG/M |
| 3300002510 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300003688 | Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300005244 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1000_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005245 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005246 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005247 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005248 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005249 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005250 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005251 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005388 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005390 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005409 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005411 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005480 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005486 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005490 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005492 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005494 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005495 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005638 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006359 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP_1400 MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006380 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006848 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007000 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010176 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010183 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010184 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010191 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010195 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010196 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300020153 | Sediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 60_MetaG | Environmental | Open in IMG/M |
| 3300026293 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027279 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027515 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031512 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031515 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2 | Environmental | Open in IMG/M |
| 3300031517 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2 | Environmental | Open in IMG/M |
| 3300031567 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1 | Environmental | Open in IMG/M |
| 3300031568 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031776 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031865 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3 | Environmental | Open in IMG/M |
| 3300031875 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13 | Environmental | Open in IMG/M |
| 3300031878 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4 | Environmental | Open in IMG/M |
| 3300031948 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1 | Environmental | Open in IMG/M |
| 3300031950 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65 | Environmental | Open in IMG/M |
| 3300031966 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55 | Environmental | Open in IMG/M |
| 3300032034 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2 | Environmental | Open in IMG/M |
| 3300032049 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60 | Environmental | Open in IMG/M |
| 3300032058 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| 3300033886 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd | Environmental | Open in IMG/M |
| 3300034647 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0600_MSt7 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034648 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1000_MSt9 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24185J35167_10111521 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | SRDFSRQAASGNTLSHKVRRSDTRNSHATRCAKSLSEKL* |
| JGI24185J35167_10128701 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | LTPAQAGFPPASRDFSRQAASGTTLSHQVRRSDARNRHATRCAQSLSEKL* |
| JGI24186J35511_10097942 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHATQCAESLSEKL* |
| JGI24186J35511_10097943 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MRSXXPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCAESLSEKL* |
| JGI24186J35511_10363131 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MRPLKPAQAGFPPASRDFRRQAASGNILAHKVRRSATRNRHATWCAQRLSEPLEPFRLWRDR |
| JGI24186J35511_10399611 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLXPAQAGFPPASRDFSRQAASGNTPSHKVRRSGTRNSHATRCAKSLSEKL* |
| Ga0061020_10389774 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPAQAGFPPASRDFSRQAASGTTLSHXVRRSDARNRHATRCAQSLSEKL* |
| Ga0061020_10920521 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | RRAGLQASGMRSLTPAQAGFPPASRDFSRQAASGNTLSHQVRRADPRNRHATRCAESLSEKL* |
| Ga0068644_10185522 | 3300005244 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPVQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQRLSEPL |
| Ga0068640_1219991 | 3300005245 | Anoxygenic And Chlorotrophic Microbial Mat | AQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCAESLSAKL* |
| Ga0068640_1301951 | 3300005245 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCA |
| Ga0068638_1249251 | 3300005246 | Anoxygenic And Chlorotrophic Microbial Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHAT |
| Ga0068637_10309022 | 3300005247 | Anoxygenic And Chlorotrophic Microbial Mat | MRPLTPAQAGFPPASRDFSRQAASGNPLSHKVRRSDTRNSHATQCAESLSEKL* |
| Ga0068636_10326591 | 3300005248 | Anoxygenic And Chlorotrophic Microbial Mat | LRASGMRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSNTRNRHATRCAQSLSAKL* |
| Ga0068636_10326592 | 3300005248 | Anoxygenic And Chlorotrophic Microbial Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAQSLSEKL* |
| Ga0068636_10806802 | 3300005248 | Anoxygenic And Chlorotrophic Microbial Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNR |
| Ga0068645_11164583 | 3300005249 | Anoxygenic And Chlorotrophic Microbial Mat | AQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCAQSLSEKL* |
| Ga0068635_10500702 | 3300005250 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRC |
| Ga0068635_11098961 | 3300005250 | Anoxygenic And Chlorotrophic Microbial Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHATRC |
| Ga0068635_11098962 | 3300005250 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPAQAGFPPARRDFSRQAASGNTLSHKVRRSDARNSHATRCAESLSEKL* |
| Ga0068634_10490081 | 3300005251 | Anoxygenic And Chlorotrophic Microbial Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVVVPPRETV |
| Ga0068634_11283711 | 3300005251 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPAQAGFPPARRDFSRQAASGNTLSHKVRRSDARNSHATRCAESLSEK |
| Ga0068652_1037542 | 3300005388 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATQCAESLSEKL* |
| Ga0068657_1070321 | 3300005390 | Anoxygenic And Chlorotrophic Microbial Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHAT |
| Ga0068657_1199512 | 3300005390 | Anoxygenic And Chlorotrophic Microbial Mat | VEVRRAGLRAGGMRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAESLSEKR* |
| Ga0068651_10095295 | 3300005409 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPAQAGFPSASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQRLSE |
| Ga0068647_10407752 | 3300005411 | Anoxygenic And Chlorotrophic Microbial Mat | MRSFKPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHATRCAKSLSEKL* |
| Ga0068706_10616031 | 3300005452 | Anoxygenic And Chlorotrophic | VRRAGLRASGMRSLTPAQAGFPPASRDFSRQAASGNTLSHQVRRSDTRNRHATRCAQSLSEKL* |
| Ga0068705_101396391 | 3300005453 | Anoxygenic And Chlorotrophic | PPASRDFSRQAASGNTLSHQVRRSDTRNRHATRCAQSLSEKL* |
| Ga0068661_1109771 | 3300005480 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLTPAQAGFPPARRDFSRQAASGNTLSHKVRRSDARNSHATR |
| Ga0068661_1109773 | 3300005480 | Anoxygenic And Chlorotrophic Microbial Mat | RASGMRSFKPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHATRCAESLSEKL* |
| Ga0068660_1031411 | 3300005486 | Anoxygenic And Chlorotrophic Microbial Mat | MRPRKPAQAGFLPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQRLSEPLE |
| Ga0068660_1151362 | 3300005486 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLKPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRYAQSLSEKL* |
| Ga0068660_1175841 | 3300005486 | Anoxygenic And Chlorotrophic Microbial Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRS |
| Ga0068660_1218041 | 3300005486 | Anoxygenic And Chlorotrophic Microbial Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATR |
| Ga0068662_1292631 | 3300005490 | Anoxygenic And Chlorotrophic Microbial Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHAT |
| Ga0068665_1115171 | 3300005492 | Anoxygenic And Chlorotrophic Microbial Mat | MRSFKPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCAESLSAKL* |
| Ga0068665_1152813 | 3300005492 | Anoxygenic And Chlorotrophic Microbial Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRN |
| Ga0068668_10278241 | 3300005494 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLKPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSH |
| Ga0068668_10383362 | 3300005494 | Anoxygenic And Chlorotrophic Microbial Mat | GMRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAESLSAKL* |
| Ga0068666_10148882 | 3300005495 | Anoxygenic And Chlorotrophic Microbial Mat | VEVRRAGLRASGMRSLTPAQAGFPPASRDFSRQAASGTTLSHKVRRSDTRNSHATRCAESLSAKL* |
| Ga0068669_11510813 | 3300005638 | Anoxygenic And Chlorotrophic Microbial Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSAT |
| Ga0068676_10162721 | 3300006359 | Anoxygenic And Chlorotrophic Microbial Mat | VEVRRAGLRAGGMRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNRHATRCAESLSAKL* |
| Ga0068664_10354923 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | QAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAESLSEKL* |
| Ga0068664_11645381 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCAES |
| Ga0068664_11645383 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | LTPAQAGFPPASRDFSRQAASGNPLSHKVRRSDTRNSHATQCAESLSEKL* |
| Ga0101768_12206972 | 3300006848 | Anoxygenic And Chlorotrophic Microbial Mat | ASGMRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAESLSEKR* |
| Ga0102499_10902401 | 3300007000 | Anoxygenic And Chlorotrophic Microbial Mat | KPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRYAQSLSEKL* |
| Ga0124933_1751942 | 3300010176 | Anoxygenic And Chlorotrophic Microbial Mat | MRSFKPAQAGFPPASRDFSRQAASGNTLSHKVRRSD |
| Ga0124919_10917281 | 3300010183 | Anoxygenic And Chlorotrophic Microbial Mat | MRSLKPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATR |
| Ga0124920_11246792 | 3300010184 | Anoxygenic And Chlorotrophic Microbial Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRH |
| Ga0124914_10773571 | 3300010191 | Anoxygenic And Chlorotrophic Microbial Mat | PAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCAESLSAKL* |
| Ga0124911_11585212 | 3300010195 | Anoxygenic And Chlorotrophic Microbial Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQRLSEPLEPF |
| Ga0124923_10718431 | 3300010196 | Anoxygenic And Chlorotrophic Microbial Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHKVRRSATRNRHATR |
| Ga0197142_10042821 | 3300020153 | Sediment | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRHSDTRNSHATR |
| Ga0209227_10829592 | 3300026293 | Anoxygenic And Chlorotrophic Microbial Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHQVRRSDTRNSHATRCAESLS |
| Ga0209809_11406731 | 3300026509 | Anoxygenic And Chlorotrophic | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHATR |
| Ga0209809_11564202 | 3300026509 | Anoxygenic And Chlorotrophic | MRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHATR |
| Ga0209691_10281431 | 3300027279 | Anoxygenic And Chlorotrophic | MRSLTPAQAGFPPASRDFSRQAASGTTLSHKVRRSATRNRHATWCA |
| Ga0209691_10552302 | 3300027279 | Anoxygenic And Chlorotrophic | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATR |
| Ga0209162_11465331 | 3300027515 | Anoxygenic And Chlorotrophic | MRSLTPAQAGFPPASRDFSRQAASGNTLSHQVRRSDTRNSHATRCAESLS |
| Ga0308395_10789501 | 3300031245 | Hot Spring Phototrophic Mat | TPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAESLSAKL |
| Ga0308395_11472151 | 3300031245 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCA |
| Ga0308394_10537242 | 3300031508 | Hot Spring Phototrophic Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATR |
| Ga0308399_10074471 | 3300031509 | Hot Spring Phototrophic Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSA |
| Ga0308397_11077661 | 3300031512 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATR |
| Ga0308397_11283991 | 3300031512 | Hot Spring Phototrophic Mat | TPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCAQSLSAKL |
| Ga0308412_10747931 | 3300031513 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDAR |
| Ga0308412_11045722 | 3300031513 | Hot Spring Phototrophic Mat | MRSLKPAQAGFLPASRDFSRQAASETTLSHQVRRSATRNRHATRCAQRLSKKL |
| Ga0308412_11066191 | 3300031513 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSRQAASGNPLSHKVRRSATRNRHATRCAK |
| Ga0308412_11714351 | 3300031513 | Hot Spring Phototrophic Mat | RASGMRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNRHATRCAQSLSEKL |
| Ga0308396_10615191 | 3300031515 | Hot Spring Phototrophic Mat | RASGMRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAQSLSEKL |
| Ga0308392_10931841 | 3300031517 | Hot Spring Phototrophic Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQSLSE |
| Ga0308391_10964591 | 3300031567 | Hot Spring Phototrophic Mat | MRSFKPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRCAE |
| Ga0308393_10217141 | 3300031568 | Hot Spring Phototrophic Mat | GMRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHATRCAESLSEKL |
| Ga0308393_10901371 | 3300031568 | Hot Spring Phototrophic Mat | GMRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHSTWCAESLSEKL |
| Ga0308401_10840651 | 3300031767 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSRQAASGNTLSHQVRRSDTRNRHATRCAQSLS |
| Ga0308415_10837141 | 3300031776 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARN |
| Ga0308418_11219001 | 3300031783 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSLQAASGTTLSHQVRRSATRNRH |
| Ga0308418_11284291 | 3300031783 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATR |
| Ga0308411_102175141 | 3300031812 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSRQAASGNPLSHKVRRSATRNRHATRCAKSLSEKLE |
| Ga0308411_102780383 | 3300031812 | Hot Spring Phototrophic Mat | MRPRKPAQAGFLPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQR |
| Ga0308411_103049003 | 3300031812 | Hot Spring Phototrophic Mat | MRPLKPAQAGFPPASRDFSRQAASGNPLSHQVRRS |
| Ga0308408_10471121 | 3300031865 | Hot Spring Phototrophic Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQ |
| Ga0308408_10572881 | 3300031865 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPARRDFSRQAASGNTLSHKVRRS |
| Ga0308408_10791771 | 3300031865 | Hot Spring Phototrophic Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATR |
| Ga0308408_11460151 | 3300031865 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNS |
| Ga0308405_11601531 | 3300031875 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSRQAASGNTLSHKVRRS |
| Ga0308404_10478311 | 3300031878 | Hot Spring Phototrophic Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHKIRRSAT |
| Ga0308404_10854531 | 3300031878 | Hot Spring Phototrophic Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRN |
| Ga0308406_10813741 | 3300031948 | Hot Spring Phototrophic Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQR |
| Ga0308417_10733381 | 3300031950 | Hot Spring Phototrophic Mat | MRPLKPAQAGFPPASRDFSRQAASGNTLAHKVRRSDTRNSHATRCAKSLSETL |
| Ga0308417_11764003 | 3300031950 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRN |
| Ga0308417_11892141 | 3300031950 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSRQAASGTTLSHQVRRSA |
| Ga0308417_12336621 | 3300031950 | Hot Spring Phototrophic Mat | ASGMRSLKPAQAGFPPASRDFSRQAASGTTLSHKVRRSATRNRHATRCAQSLFEQL |
| Ga0308417_12619761 | 3300031950 | Hot Spring Phototrophic Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQRLSEPLE |
| Ga0308420_10612951 | 3300031966 | Hot Spring Phototrophic Mat | MRSLTPAQAGFPPASRDFSRQAASGNTLSHQVRRSDTR |
| Ga0308407_10675472 | 3300032034 | Hot Spring Phototrophic Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATRCAQRLSEPLEPFRLR |
| Ga0308416_10723191 | 3300032049 | Hot Spring Phototrophic Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHKVRRSATRNRHATRCAQRLSEPLE |
| Ga0308419_11943341 | 3300032058 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHQVRRSDARNR |
| Ga0308414_10887021 | 3300032356 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGTTLSHQVRRSATRNRHATR |
| Ga0308414_11215382 | 3300032356 | Hot Spring Phototrophic Mat | MRSRKPAQAGFPPASRDFSRQAASGTTLSHQVRRSA |
| Ga0308414_11721551 | 3300032356 | Hot Spring Phototrophic Mat | AGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAQSLSEKL |
| Ga0308413_015144_1857_2018 | 3300033886 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNRHATRCAQSLSEKL |
| Ga0308413_072371_249_410 | 3300033886 | Hot Spring Phototrophic Mat | MRSLKPAQAGFPPASRDFSRQAASGNTLSHKVRRSDTRNSHATRYAQSLSEKL |
| Ga0308413_150945_3_119 | 3300033886 | Hot Spring Phototrophic Mat | MRPRKPAQAGFPPASRDFSRQAASGTTLSHKVRRSDTRN |
| Ga0308413_154336_2_157 | 3300033886 | Hot Spring Phototrophic Mat | MRPLTPAQAGFPPASRDFSRQAASGNTLSHKVRRSDARNSHATRCAESLSEK |
| Ga0372968_032156_571_684 | 3300034647 | Hot Spring Phototrophic Mat | MRSRKPAQAGFPPASRDFRRQAASGTTLSHKVRRSATR |
| Ga0372970_047599_125_286 | 3300034648 | Hot Spring Phototrophic Mat | MRSLTPAQAGFLPASRDFSRQAASGNTLSYKVRRSNTRNRHATRCAQSLSAKL |
| ⦗Top⦘ |