


| Basic Information | |
|---|---|
| Family ID | F088932 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MANSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECPARS |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 18.52 % |
| % of genes near scaffold ends (potentially truncated) | 95.41 % |
| % of genes from short scaffolds (< 2000 bps) | 84.40 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.376 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (15.596 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.716 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.578 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 34.78% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01713 | Smr | 3.67 |
| PF00085 | Thioredoxin | 2.75 |
| PF01341 | Glyco_hydro_6 | 1.83 |
| PF01223 | Endonuclease_NS | 0.92 |
| PF00535 | Glycos_transf_2 | 0.92 |
| PF01966 | HD | 0.92 |
| PF09258 | Glyco_transf_64 | 0.92 |
| PF00037 | Fer4 | 0.92 |
| PF01583 | APS_kinase | 0.92 |
| PF00578 | AhpC-TSA | 0.92 |
| PF00156 | Pribosyltran | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG5297 | Cellulase/cellobiase CelA1 | Carbohydrate transport and metabolism [G] | 1.83 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.92 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.38 % |
| All Organisms | root | All Organisms | 48.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001346|JGI20151J14362_10111250 | Not Available | 911 | Open in IMG/M |
| 3300001938|GOS2221_1000085 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300001962|GOS2239_1021842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1916 | Open in IMG/M |
| 3300003345|JGI26080J50196_1002557 | Not Available | 7291 | Open in IMG/M |
| 3300003427|JGI26084J50262_1057686 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 897 | Open in IMG/M |
| 3300005523|Ga0066865_10330705 | Not Available | 577 | Open in IMG/M |
| 3300005837|Ga0078893_10321848 | Not Available | 21645 | Open in IMG/M |
| 3300006401|Ga0075506_1608187 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 702 | Open in IMG/M |
| 3300006737|Ga0098037_1284756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300006789|Ga0098054_1243641 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 649 | Open in IMG/M |
| 3300006990|Ga0098046_1033943 | Not Available | 1237 | Open in IMG/M |
| 3300007345|Ga0070752_1003978 | Not Available | 8880 | Open in IMG/M |
| 3300007345|Ga0070752_1379741 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 526 | Open in IMG/M |
| 3300007552|Ga0102818_1110109 | Not Available | 548 | Open in IMG/M |
| 3300007718|Ga0102852_1123316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300007954|Ga0105739_1124611 | Not Available | 601 | Open in IMG/M |
| 3300008012|Ga0075480_10593055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300008470|Ga0115371_11319221 | Not Available | 1500 | Open in IMG/M |
| 3300009071|Ga0115566_10111461 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1747 | Open in IMG/M |
| 3300009420|Ga0114994_10602857 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 720 | Open in IMG/M |
| 3300009420|Ga0114994_11125971 | Not Available | 506 | Open in IMG/M |
| 3300009426|Ga0115547_1291349 | Not Available | 509 | Open in IMG/M |
| 3300009433|Ga0115545_1152029 | Not Available | 808 | Open in IMG/M |
| 3300009437|Ga0115556_1252649 | Not Available | 626 | Open in IMG/M |
| 3300009443|Ga0115557_1182756 | Not Available | 830 | Open in IMG/M |
| 3300009447|Ga0115560_1175810 | Not Available | 839 | Open in IMG/M |
| 3300009507|Ga0115572_10170442 | Not Available | 1269 | Open in IMG/M |
| 3300009507|Ga0115572_10357245 | Not Available | 822 | Open in IMG/M |
| 3300010148|Ga0098043_1212039 | Not Available | 534 | Open in IMG/M |
| 3300010150|Ga0098056_1047728 | All Organisms → Viruses → Predicted Viral | 1484 | Open in IMG/M |
| 3300010368|Ga0129324_10011968 | All Organisms → Viruses → Predicted Viral | 4527 | Open in IMG/M |
| 3300012920|Ga0160423_10039994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 3443 | Open in IMG/M |
| 3300012928|Ga0163110_10968923 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 676 | Open in IMG/M |
| 3300016781|Ga0182063_1607369 | Not Available | 711 | Open in IMG/M |
| 3300017697|Ga0180120_10343815 | Not Available | 591 | Open in IMG/M |
| 3300017697|Ga0180120_10436185 | Not Available | 512 | Open in IMG/M |
| 3300017729|Ga0181396_1110059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300017732|Ga0181415_1064474 | Not Available | 830 | Open in IMG/M |
| 3300017740|Ga0181418_1134809 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300017741|Ga0181421_1180708 | Not Available | 542 | Open in IMG/M |
| 3300017742|Ga0181399_1176666 | Not Available | 507 | Open in IMG/M |
| 3300017746|Ga0181389_1009905 | All Organisms → Viruses → Predicted Viral | 3186 | Open in IMG/M |
| 3300017749|Ga0181392_1160751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300017752|Ga0181400_1103732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
| 3300017752|Ga0181400_1187797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300017769|Ga0187221_1020545 | All Organisms → Viruses → Predicted Viral | 2314 | Open in IMG/M |
| 3300017782|Ga0181380_1166832 | Not Available | 746 | Open in IMG/M |
| 3300017824|Ga0181552_10025479 | All Organisms → Viruses → Predicted Viral | 3666 | Open in IMG/M |
| 3300017951|Ga0181577_10505114 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 756 | Open in IMG/M |
| 3300017986|Ga0181569_10111039 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1951 | Open in IMG/M |
| 3300017986|Ga0181569_10380029 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 969 | Open in IMG/M |
| 3300018049|Ga0181572_10072611 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300018049|Ga0181572_10492354 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 756 | Open in IMG/M |
| 3300018421|Ga0181592_10016455 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 6037 | Open in IMG/M |
| 3300018424|Ga0181591_11117063 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 530 | Open in IMG/M |
| 3300020178|Ga0181599_1075273 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
| 3300020189|Ga0181578_10124223 | Not Available | 1402 | Open in IMG/M |
| 3300020189|Ga0181578_10403172 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 596 | Open in IMG/M |
| 3300020347|Ga0211504_1069656 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 813 | Open in IMG/M |
| 3300020394|Ga0211497_10285093 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 617 | Open in IMG/M |
| 3300020403|Ga0211532_10169115 | Not Available | 887 | Open in IMG/M |
| 3300020421|Ga0211653_10126569 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1132 | Open in IMG/M |
| 3300020454|Ga0211548_10029349 | Not Available | 2545 | Open in IMG/M |
| 3300020461|Ga0211535_10123242 | Not Available | 1114 | Open in IMG/M |
| 3300020464|Ga0211694_10027075 | Not Available | 2190 | Open in IMG/M |
| 3300020472|Ga0211579_10692129 | Not Available | 568 | Open in IMG/M |
| 3300020810|Ga0181598_1095939 | All Organisms → Viruses → Predicted Viral | 1288 | Open in IMG/M |
| 3300021964|Ga0222719_10577475 | Not Available | 659 | Open in IMG/M |
| 3300022925|Ga0255773_10281580 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 691 | Open in IMG/M |
| 3300023178|Ga0255759_10340051 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 930 | Open in IMG/M |
| 3300023178|Ga0255759_10524169 | Not Available | 690 | Open in IMG/M |
| 3300023178|Ga0255759_10813447 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 501 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10092875 | All Organisms → Viruses → Predicted Viral | 1395 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10358838 | Not Available | 541 | Open in IMG/M |
| 3300024281|Ga0228610_1040349 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 629 | Open in IMG/M |
| 3300024293|Ga0228651_1083217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300024296|Ga0228629_1149036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300024297|Ga0228658_1018946 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1788 | Open in IMG/M |
| 3300024314|Ga0228657_1002575 | Not Available | 5435 | Open in IMG/M |
| 3300024346|Ga0244775_10304684 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1321 | Open in IMG/M |
| 3300024348|Ga0244776_10743033 | Not Available | 600 | Open in IMG/M |
| 3300025086|Ga0208157_1105286 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 672 | Open in IMG/M |
| 3300025617|Ga0209138_1133167 | Not Available | 666 | Open in IMG/M |
| 3300025636|Ga0209136_1040351 | Not Available | 1652 | Open in IMG/M |
| 3300025695|Ga0209653_1001881 | Not Available | 16136 | Open in IMG/M |
| 3300025701|Ga0209771_1146824 | Not Available | 730 | Open in IMG/M |
| 3300025759|Ga0208899_1158584 | Not Available | 765 | Open in IMG/M |
| 3300025816|Ga0209193_1144045 | Not Available | 557 | Open in IMG/M |
| 3300025892|Ga0209630_10449221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300026447|Ga0247607_1069896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300026462|Ga0247568_1114131 | Not Available | 532 | Open in IMG/M |
| 3300026500|Ga0247592_1130021 | Not Available | 603 | Open in IMG/M |
| 3300026503|Ga0247605_1035587 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1245 | Open in IMG/M |
| 3300027631|Ga0208133_1155158 | Not Available | 527 | Open in IMG/M |
| 3300027757|Ga0208671_10140938 | Not Available | 878 | Open in IMG/M |
| 3300027771|Ga0209279_10006600 | Not Available | 4488 | Open in IMG/M |
| 3300027788|Ga0209711_10189305 | Not Available | 957 | Open in IMG/M |
| 3300027810|Ga0209302_10092494 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
| 3300027883|Ga0209713_10432116 | Not Available | 866 | Open in IMG/M |
| 3300028110|Ga0247584_1083656 | Not Available | 805 | Open in IMG/M |
| 3300028126|Ga0228648_1116593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300028131|Ga0228642_1003149 | Not Available | 5535 | Open in IMG/M |
| 3300028284|Ga0257120_1099032 | Not Available | 631 | Open in IMG/M |
| 3300029318|Ga0185543_1017757 | Not Available | 1692 | Open in IMG/M |
| 3300031143|Ga0308025_1081325 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
| 3300031519|Ga0307488_10123640 | All Organisms → Viruses → Predicted Viral | 1850 | Open in IMG/M |
| 3300031703|Ga0308002_1059779 | Not Available | 852 | Open in IMG/M |
| 3300031721|Ga0308013_10350693 | Not Available | 508 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 15.60% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.93% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 11.01% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.09% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.17% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 8.26% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 7.34% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.59% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.67% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.75% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.75% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.83% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.83% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.92% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.92% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.92% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.92% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.92% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300001962 | Marine microbial communities from Cocos Island, Costa Rica - GS023 | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300016781 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
| 3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026462 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300028284 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031703 | Marine microbial communities from water near the shore, Antarctic Ocean - #34 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20151J14362_101112504 | 3300001346 | Pelagic Marine | MTNSWYYTEMGSRNKKTGKLSYYQVRVTDYRIDDCNCKA |
| GOS2221_10000853 | 3300001938 | Marine | MGSRSKKTGKLSYYNVKVTDYHISDCECKAREFRAHTPCKHMKR |
| GOS2239_10218425 | 3300001962 | Marine | MDILPMLNKWQYREMGSRNKKTGKLSYYNVTVIDYHISDC |
| JGI26080J50196_10025572 | 3300003345 | Marine | MTSWKYREMGSRNKKTGKLSHYDVTVTDYKISDCECKAREFRNTHHVNI* |
| JGI26084J50262_10576861 | 3300003427 | Marine | MSKYVYLEMGSRNKKTGKLPKYKVIVQDNKISDCDCPARGFRK |
| Ga0066865_103307054 | 3300005523 | Marine | MDKTMNSWYYREMGSRNKKTGKLNYYQVKVTDYKIDDCECM |
| Ga0078893_1032184837 | 3300005837 | Marine Surface Water | MTNSWYYREMGSRNKKTGKLSYYQVRVTDYVIDDCECPARXNI* |
| Ga0075506_16081871 | 3300006401 | Aqueous | MTNSWYYREMGSRNKKTGKLSYYQVRVTDYRIDDCE |
| Ga0098037_12847562 | 3300006737 | Marine | MARSWKFREMGSRNKKTGELSYYNVTVTDFRISDCECKAR |
| Ga0098054_12436413 | 3300006789 | Marine | MTNSWYYTEMGSRNKKTGKLSYYQVRVTDYRIDDCNCKAR |
| Ga0098046_10339435 | 3300006990 | Marine | MKVSWYYREMGSRNKKTGKLSYYNVKVTDYKISDCECKAREFRPH |
| Ga0070752_10039781 | 3300007345 | Aqueous | MARSWKFREMGSRNKKTGKLSYYDVTVIDHRISNCNCKAKEFRL |
| Ga0070752_13797413 | 3300007345 | Aqueous | MTNSWYYREMGSRNKKTGKLSYYRVRVTDYKIDDCE |
| Ga0102818_11101093 | 3300007552 | Estuarine | MTNSWYYREMGSRNKKTGKLSYYNVKVTDYKIDDCECPARSFRS |
| Ga0102852_11233163 | 3300007718 | Estuarine | MTNSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCE |
| Ga0105739_11246111 | 3300007954 | Estuary Water | MTNSWYYTEMGSRNKKTGKLSYYQVRVTDYKIDDCEC |
| Ga0075480_105930552 | 3300008012 | Aqueous | MKWKYRELGSRNKKTGIHSYYNVTVTDWVITDCECKAREFN |
| Ga0115371_113192216 | 3300008470 | Sediment | MTETWSYKEMGSRNKKTGKLSYYEVTVENYKIVDCECPARQ |
| Ga0115566_101114616 | 3300009071 | Pelagic Marine | MARSWKFREMGSRNKKTGKLSYYDVTVTDHRISNC |
| Ga0114994_106028573 | 3300009420 | Marine | MNNSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECPARS |
| Ga0114994_111259711 | 3300009420 | Marine | MANSWYYREMGSRNKKTGKLSYYNVTVTDYTVVDCECPAR |
| Ga0115547_12913491 | 3300009426 | Pelagic Marine | MARSWKFREMGSRNKKNGKLSYYDVTVTDHRISNCNCKAKE |
| Ga0115545_11520294 | 3300009433 | Pelagic Marine | MKEWQYREMGSRNKKSGKLSYYKVTVRDWRIVDCECKARELRRY |
| Ga0115556_12526493 | 3300009437 | Pelagic Marine | MKEWQYREMGSRNKKSGKLSYYKVTVEDWVITNCECPAREF |
| Ga0115557_11827563 | 3300009443 | Pelagic Marine | MTNSWYYTEMGSRNKKTGKLSYYQVRVTDYRIDDCNCKAREFRSYS |
| Ga0115560_11758101 | 3300009447 | Pelagic Marine | MTNSWYYTEMGSRNKKTGKLSYYQVRVTDYRIDDCNCK |
| Ga0115572_101704426 | 3300009507 | Pelagic Marine | MKSSWYYREMGSRNKKTGKLSHYDVKVTDYKISDCECKAREFR |
| Ga0115572_103572454 | 3300009507 | Pelagic Marine | MKEWQYREMGSRNKKSGKLSYYKVTVRDWRIVDCECKAR |
| Ga0098043_12120391 | 3300010148 | Marine | MTNSWYYREMGSRDKKGNLKYYQVRVVDYKIDDCECMARQFRPYSPCK |
| Ga0098056_10477281 | 3300010150 | Marine | MSESWKFREMGSRNKKTGKLSYYDVTVTNWKISDCECKARE |
| Ga0129324_100119689 | 3300010368 | Freshwater To Marine Saline Gradient | MKWQYREMGSRNKKTGKLSYYNVTVKDFKISDCECKAREFYRYT |
| Ga0160423_100399941 | 3300012920 | Surface Seawater | MNSWYYREMGSRNKKTGKLNYYQVKVTDYKIDDCECMARQ |
| Ga0163110_109689233 | 3300012928 | Surface Seawater | MTNSWYYREMGSRDKKGNLKYYQVRVTDYKIDDCECM |
| Ga0182063_16073693 | 3300016781 | Salt Marsh | MTNSWYYREMGSRNKKTGKLSYYRVRVTDYKIDDCDCK |
| Ga0180120_103438151 | 3300017697 | Freshwater To Marine Saline Gradient | MEKWTYREMGSRNKKTGKLSYYTVTVTDFKITDCECPAREFRS |
| Ga0180120_104361851 | 3300017697 | Freshwater To Marine Saline Gradient | MKKWTYREMGSRNKKTGKLSYYTVTVTDFKITDCECPAREFRS |
| Ga0181396_11100592 | 3300017729 | Seawater | MTNSSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCE |
| Ga0181415_10644745 | 3300017732 | Seawater | MDKTMNSWYYREMGSRNKKTHKLSYYQVRVTDYTIDDCECMARQFRPHS |
| Ga0181418_11348091 | 3300017740 | Seawater | MSESWKFREMGSRNKKTGKLSYYDVTVTDWKIVDCECKAREFSRYTPCK |
| Ga0181421_11807081 | 3300017741 | Seawater | MRKWQYREMGSRNKKTGKVSHYTVTVTDYRITDGECKAREFRPY |
| Ga0181399_11766663 | 3300017742 | Seawater | MRKWQYREMGSRNKKTGKLSYYNVTVTDYRITDCECKA |
| Ga0181389_100990512 | 3300017746 | Seawater | MARSWKFREMGSRNKKTGKLSYYNVTVTDYKITDCECKAR |
| Ga0181392_11607513 | 3300017749 | Seawater | MTSSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECKAREFR |
| Ga0181400_11037321 | 3300017752 | Seawater | MARSWKFREMGSRDKKTGKLSYYTVTVTDYRISNCECKARQFKPYLP |
| Ga0181400_11877973 | 3300017752 | Seawater | MINSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECP |
| Ga0187221_10205455 | 3300017769 | Seawater | MSESWKFREMGSRNKKTGKLSYYDVTVTDWKIVDCECKAR |
| Ga0181380_11668323 | 3300017782 | Seawater | MKSSWYYREMGSRNKKTGKLSYYNVKVTDYKISDCECKA |
| Ga0181552_100254791 | 3300017824 | Salt Marsh | MENSWYYREMGSRNKKTGKLSYYQVKVTDYKIVDCECPARS |
| Ga0181577_105051141 | 3300017951 | Salt Marsh | MENSWYYREMGSRNKKTGKLNYYQVKVTDYKIVDCECPARSF |
| Ga0181569_101110394 | 3300017986 | Salt Marsh | MNTWYYKEMGSRNKKTGKLSMYRVKVTDHKIVDCDCKAREFRRYS |
| Ga0181569_103800293 | 3300017986 | Salt Marsh | MENSWYYREMGSRNKKTGKLSYYQVKVTDYKIVDCECPARSFRA |
| Ga0181572_100726111 | 3300018049 | Salt Marsh | MENSWYYREMGSRNKKTGKLSYYQVKVTDYKIVDCE |
| Ga0181572_104923543 | 3300018049 | Salt Marsh | MNQWNYREMGSRNKKTGKLNYYQVTVTDYKISDCSCP |
| Ga0181592_100164551 | 3300018421 | Salt Marsh | MNQWNYREMGSRNKKTGKLNYYQVTVTDYKISDCSCPAR |
| Ga0181591_111170633 | 3300018424 | Salt Marsh | MANSWYYREMGSRDKKGKLKYYQVRVTDYKIDDCE |
| Ga0181599_10752731 | 3300020178 | Salt Marsh | MASWKYREMGSRNKKTGKLSYYDVTVTDWKIVDCEC |
| Ga0181578_101242236 | 3300020189 | Salt Marsh | MTSWYYKEMGSRNKKTGKLSYYRVKVTDWKISDCDCKAREF |
| Ga0181578_104031723 | 3300020189 | Salt Marsh | MANSWYYREMGSRNKKTGKLSYYNVRVTDYVIDDCECPARMFR |
| Ga0211504_10696561 | 3300020347 | Marine | MMKSSWYYREMGSRNKKTGKLSHYNVKVTDYKISDCECKAREFRAHTPC |
| Ga0211497_102850933 | 3300020394 | Marine | MDSWYYREMGSRNKKTQKLSYYNVRVTDYKIDDCECMARQFRPYSPC |
| Ga0211532_101691155 | 3300020403 | Marine | MDKTMNSYYYREMGSRNKKTGKLNYYQVKVTDYKIDDCECMARQFRP |
| Ga0211653_101265691 | 3300020421 | Marine | MADSWYYREMGSRDKKGNLKYYQVRVVDYKIDDCECMARQF |
| Ga0211548_100293491 | 3300020454 | Marine | MDSWYYREMGSRNKKTQKLSYYNVRVTDYVIDDCECMARQFRPH |
| Ga0211535_101232421 | 3300020461 | Marine | MDRKNSWYYREMGSRNKKTGKLNYYNVRVTEHKIDDCECMAR |
| Ga0211694_100270751 | 3300020464 | Marine | MDSWYYREMGSRNKKTQKLSYYNVRVTDYVIDDCE |
| Ga0211579_106921291 | 3300020472 | Marine | MDKTMNSWYYREMGSRNKKTGKLNYYQVKVTDYKID |
| Ga0181598_10959391 | 3300020810 | Salt Marsh | MKWQYKEMGSRNKKTGKLSYYRVTVEDWKITNCECKA |
| Ga0222719_105774751 | 3300021964 | Estuarine Water | MENSWKYREMGSRNKKTGRLPYYQVTVTDYKISDCSCP |
| Ga0255773_102815803 | 3300022925 | Salt Marsh | MANSWYYREMGSRDKKGKLKYYQVRVTDYKIDDCEC |
| Ga0255759_103400511 | 3300023178 | Salt Marsh | MENSWYYREMGSRNKKTGKLSYYQVKVIDYKISDCECMARQF |
| Ga0255759_105241691 | 3300023178 | Salt Marsh | MKWQYKEMGSRNKKTGKLSYYRVTVEDWKIVDCECKAREFRRHS |
| Ga0255759_108134472 | 3300023178 | Salt Marsh | MENSWYYREMGSRNKKTGKLSYYQVKVTDYKIVDCECPARSF |
| (restricted) Ga0233438_100928751 | 3300024255 | Seawater | MKSSWKYREMGSRNKKTGKLSHYDVTVTDYKISDCECKAREFRKH |
| (restricted) Ga0233438_103588381 | 3300024255 | Seawater | MTSWKYREMGSRNKKTGKLSHYDVTVTDYKISDCECKAREFRKH |
| Ga0228610_10403491 | 3300024281 | Seawater | MTNSWYYTEMGSRNKKTGKLSYYQVRVTDYRIDDCNCKARE |
| Ga0228651_10832171 | 3300024293 | Seawater | MARSWKFREMGSRDKKTGKLSYYTVTVTDYRISNCE |
| Ga0228629_11490363 | 3300024296 | Seawater | MARSWKFREMGSRDKKTGKLSYYTVTVTDHRISNCECK |
| Ga0228658_10189466 | 3300024297 | Seawater | MARSWKFREMGSRDKKTGKLSYYTVTVTDYRISNCECKARQF |
| Ga0228657_10025751 | 3300024314 | Seawater | MTNSWYYTEMGSRNKKTGKLSYYQVKVTDYKIDDCN |
| Ga0244775_103046845 | 3300024346 | Estuarine | MANSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECPARS |
| Ga0244776_107430331 | 3300024348 | Estuarine | MTNSWYYTEMGSRNKKTGKLSYYQVRVTDYRIDDCN |
| Ga0208157_11052861 | 3300025086 | Marine | MLNKWQYREMGSRNKKTGKLSYYNVTVVDYHISDCECM |
| Ga0209138_11331671 | 3300025617 | Marine | MKSSWKYREMGSRNKKTGKLSHYDVTVTDYKISDCECK |
| Ga0209136_10403517 | 3300025636 | Marine | MKSSWKYREMGSRNKKTGKLSHYDVTVTDYKISDCECKARE |
| Ga0209652_10550411 | 3300025684 | Marine | MKWQYREMGSRDKKGKLSYYRVTVEDWKITDCECKAREFRRHTPCK |
| Ga0209653_100188141 | 3300025695 | Marine | MNKWHYHEMGSRNKKTGKLAYYKVTVTDYKITDCECPARSFRKYS |
| Ga0209771_11468243 | 3300025701 | Marine | MASWKYREMGSRNKKTGKLSYYDVTVTDYKISDCECKAREFRKFT |
| Ga0208899_11585843 | 3300025759 | Aqueous | MKKWQYREMGSRNKKTGKLSYYKVTVEDWVITNCECPAREF |
| Ga0209193_11440453 | 3300025816 | Pelagic Marine | MKEWQYREMGSRNKKSGKLSYYKVTVRDWRIVDCECKAREFR |
| Ga0209630_104492211 | 3300025892 | Pelagic Marine | MARSWKFREMGSRNKKTGKLSYYDVTVTDHRISNCNC |
| Ga0247607_10698961 | 3300026447 | Seawater | MTNSSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECP |
| Ga0247568_11141313 | 3300026462 | Seawater | MKSSWYYREMGSRNKKTGKLSHYNVKVTDYKISDCECKAREFRAHT |
| Ga0247592_11300213 | 3300026500 | Seawater | MTNSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECP |
| Ga0247605_10355875 | 3300026503 | Seawater | MKSSWYYREMGSRNKKTGKLSYYNVKVTDYHISDCECKAREFRAH |
| Ga0208133_11551581 | 3300027631 | Estuarine | MANSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECPA |
| Ga0208671_101409381 | 3300027757 | Estuarine | MTNSSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECPARQFRSY |
| Ga0209279_100066001 | 3300027771 | Marine | MARSWKFREMGSRNKKTGKLSYYDVTVTDHRISNCNCK |
| Ga0209711_101893054 | 3300027788 | Marine | MASWKYREMGSRNKKTGNLSYYNVTVTDYKISDCE |
| Ga0209302_100924941 | 3300027810 | Marine | MKSSWYYREMGSRSKKTGKLSYYNVKVTDYHISDCECKAREFR |
| Ga0209713_104321164 | 3300027883 | Marine | MASWKYREMGSRNKKTGNLSYYNVTVTDYKITDCNCKAREFRKYS |
| Ga0247584_10836564 | 3300028110 | Seawater | MKVSWYYREMGSRNKKTGKLSYYNVKVTDYKISDCECKAREFR |
| Ga0228648_11165932 | 3300028126 | Seawater | MTNSSWYYREMGSRNKKTGKLSYYQVRVTDYKIDDCECPARQF |
| Ga0228642_100314910 | 3300028131 | Seawater | MTNSWYYTEMGSRNKKTGKLSYYQVRVTDYRIDDCNCKAREFRSYSP |
| Ga0257120_10990323 | 3300028284 | Marine | MTNSWYYTEMGSRNKKTGKLSYYQVKVTDYKIDDCNCKAREFRSYSPCK |
| Ga0185543_10177575 | 3300029318 | Marine | MDKTMNSWYYREMGSRNKKTGKLSYYQVKVTDYKIDDCECMARQFRPHS |
| Ga0308025_10813253 | 3300031143 | Marine | MSDSWEYTEMGSRNKKTGKLSYYTVKVTDYKIVDCECPARSFRSYSP |
| Ga0307488_101236401 | 3300031519 | Sackhole Brine | MVNSWYYTEMGSRNKKTGKLSHYKVKVIDYKIEDCECPARSFRSYSP |
| Ga0308002_10597791 | 3300031703 | Marine | MSDSWEYTEMGSRNKKTGKLSYYTVKVTDYKIVDCECPARSF |
| Ga0308013_103506932 | 3300031721 | Marine | MNSWEYREMGSRNKKTGKLSYYNVRVTDYKIDDCECPARQFR |
| ⦗Top⦘ |