


| Basic Information | |
|---|---|
| Family ID | F088888 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKLTKRGKRVRAVLILIGLWAIWQVSGHLWWVEDHYCWGEMVECYFPK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 80.56 % |
| % of genes near scaffold ends (potentially truncated) | 24.77 % |
| % of genes from short scaffolds (< 2000 bps) | 57.80 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (43.119 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.853 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.560 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.725 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.16% β-sheet: 10.53% Coil/Unstructured: 51.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00206 | Lyase_1 | 6.42 |
| PF06067 | DUF932 | 5.50 |
| PF12728 | HTH_17 | 2.75 |
| PF01755 | Glyco_transf_25 | 2.75 |
| PF09723 | Zn-ribbon_8 | 2.75 |
| PF05866 | RusA | 1.83 |
| PF00383 | dCMP_cyt_deam_1 | 1.83 |
| PF04860 | Phage_portal | 1.83 |
| PF00877 | NLPC_P60 | 1.83 |
| PF07659 | DUF1599 | 1.83 |
| PF05257 | CHAP | 1.83 |
| PF00534 | Glycos_transf_1 | 0.92 |
| PF12705 | PDDEXK_1 | 0.92 |
| PF13830 | DUF4192 | 0.92 |
| PF00303 | Thymidylat_synt | 0.92 |
| PF08761 | dUTPase_2 | 0.92 |
| PF06737 | Transglycosylas | 0.92 |
| PF02467 | Whib | 0.92 |
| PF01391 | Collagen | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 2.75 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 1.83 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 1.83 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.92 |
| COG4508 | Dimeric dUTPase, all-alpha-NTP-PPase (MazG) superfamily | Nucleotide transport and metabolism [F] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.39 % |
| Unclassified | root | N/A | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002195|metazooDRAFT_1203649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300003411|JGI25911J50253_10105136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300003497|JGI25925J51416_10042591 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300003499|JGI25930J51415_1002141 | All Organisms → Viruses → Predicted Viral | 4471 | Open in IMG/M |
| 3300004096|Ga0066177_10307099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300004125|Ga0066182_10011828 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
| 3300005525|Ga0068877_10018589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4938 | Open in IMG/M |
| 3300005525|Ga0068877_10029312 | Not Available | 3787 | Open in IMG/M |
| 3300005527|Ga0068876_10584518 | Not Available | 606 | Open in IMG/M |
| 3300005528|Ga0068872_10697330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300005805|Ga0079957_1000440 | All Organisms → cellular organisms → Bacteria | 37118 | Open in IMG/M |
| 3300006484|Ga0070744_10061034 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300006484|Ga0070744_10076846 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300006484|Ga0070744_10202338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300006639|Ga0079301_1001315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11496 | Open in IMG/M |
| 3300006802|Ga0070749_10002870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 11551 | Open in IMG/M |
| 3300007165|Ga0079302_1069671 | Not Available | 770 | Open in IMG/M |
| 3300007177|Ga0102978_1136178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2794 | Open in IMG/M |
| 3300007321|Ga0102692_1513455 | Not Available | 1448 | Open in IMG/M |
| 3300007735|Ga0104988_10901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37204 | Open in IMG/M |
| 3300008107|Ga0114340_1061899 | All Organisms → Viruses → Predicted Viral | 2178 | Open in IMG/M |
| 3300008113|Ga0114346_1313324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300008116|Ga0114350_1006435 | Not Available | 10735 | Open in IMG/M |
| 3300008116|Ga0114350_1097143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300008119|Ga0114354_1184246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300008120|Ga0114355_1029840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5583 | Open in IMG/M |
| 3300008120|Ga0114355_1104370 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
| 3300008264|Ga0114353_1353414 | Not Available | 568 | Open in IMG/M |
| 3300008266|Ga0114363_1088074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
| 3300008266|Ga0114363_1098503 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300008266|Ga0114363_1161439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300008448|Ga0114876_1030939 | All Organisms → Viruses → Predicted Viral | 2620 | Open in IMG/M |
| 3300008450|Ga0114880_1060320 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300008450|Ga0114880_1276542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300009068|Ga0114973_10001244 | Not Available | 19114 | Open in IMG/M |
| 3300009152|Ga0114980_10771058 | Not Available | 536 | Open in IMG/M |
| 3300009155|Ga0114968_10072437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2158 | Open in IMG/M |
| 3300009155|Ga0114968_10534968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300009159|Ga0114978_10052071 | All Organisms → Viruses → Predicted Viral | 2822 | Open in IMG/M |
| 3300009159|Ga0114978_10063495 | All Organisms → Viruses → Predicted Viral | 2504 | Open in IMG/M |
| 3300009159|Ga0114978_10426151 | Not Available | 790 | Open in IMG/M |
| 3300009184|Ga0114976_10216129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → unclassified Mollicutes → Mollicutes bacterium | 1051 | Open in IMG/M |
| 3300010354|Ga0129333_10559012 | Not Available | 997 | Open in IMG/M |
| 3300010885|Ga0133913_10640651 | All Organisms → Viruses → Predicted Viral | 2787 | Open in IMG/M |
| 3300010885|Ga0133913_11354866 | Not Available | 1813 | Open in IMG/M |
| 3300011113|Ga0151517_1602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12324 | Open in IMG/M |
| 3300013005|Ga0164292_10210356 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300013372|Ga0177922_10004602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300017701|Ga0181364_1055621 | Not Available | 616 | Open in IMG/M |
| 3300017701|Ga0181364_1056201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300017722|Ga0181347_1096084 | Not Available | 850 | Open in IMG/M |
| 3300017723|Ga0181362_1012893 | All Organisms → Viruses → Predicted Viral | 1797 | Open in IMG/M |
| 3300017774|Ga0181358_1258442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300017777|Ga0181357_1227588 | Not Available | 655 | Open in IMG/M |
| 3300017785|Ga0181355_1349475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300019783|Ga0181361_100176 | All Organisms → Viruses → Predicted Viral | 3068 | Open in IMG/M |
| 3300019783|Ga0181361_101375 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
| 3300019784|Ga0181359_1014149 | All Organisms → Viruses → Predicted Viral | 2923 | Open in IMG/M |
| 3300019784|Ga0181359_1022873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2378 | Open in IMG/M |
| 3300019784|Ga0181359_1149773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300020159|Ga0211734_10155246 | All Organisms → Viruses → Predicted Viral | 2004 | Open in IMG/M |
| 3300020205|Ga0211731_10897294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34080 | Open in IMG/M |
| 3300020553|Ga0208855_1028755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300020554|Ga0208599_1053814 | Not Available | 572 | Open in IMG/M |
| 3300021424|Ga0194117_10130944 | All Organisms → Viruses → Predicted Viral | 1300 | Open in IMG/M |
| 3300021962|Ga0222713_10385592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300022407|Ga0181351_1061197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1547 | Open in IMG/M |
| 3300022407|Ga0181351_1101022 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300022752|Ga0214917_10010724 | Not Available | 8558 | Open in IMG/M |
| 3300022752|Ga0214917_10044699 | Not Available | 3082 | Open in IMG/M |
| 3300023174|Ga0214921_10025108 | Not Available | 6109 | Open in IMG/M |
| 3300027114|Ga0208009_1000033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36863 | Open in IMG/M |
| 3300027563|Ga0209552_1023498 | All Organisms → Viruses → Predicted Viral | 1841 | Open in IMG/M |
| 3300027608|Ga0208974_1178682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300027754|Ga0209596_1055243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2050 | Open in IMG/M |
| 3300027759|Ga0209296_1015731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4413 | Open in IMG/M |
| 3300027763|Ga0209088_10000276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37302 | Open in IMG/M |
| 3300027763|Ga0209088_10015667 | All Organisms → Viruses → Predicted Viral | 4002 | Open in IMG/M |
| 3300027782|Ga0209500_10387107 | Not Available | 566 | Open in IMG/M |
| 3300027793|Ga0209972_10001032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25605 | Open in IMG/M |
| 3300027963|Ga0209400_1008237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6848 | Open in IMG/M |
| 3300027963|Ga0209400_1299160 | Not Available | 617 | Open in IMG/M |
| 3300027973|Ga0209298_10007295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6120 | Open in IMG/M |
| 3300027973|Ga0209298_10016852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3728 | Open in IMG/M |
| 3300028025|Ga0247723_1002851 | Not Available | 8933 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1143270 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 990 | Open in IMG/M |
| 3300031758|Ga0315907_10031403 | Not Available | 4792 | Open in IMG/M |
| 3300031758|Ga0315907_10068538 | Not Available | 3078 | Open in IMG/M |
| 3300031758|Ga0315907_11220497 | Not Available | 525 | Open in IMG/M |
| 3300031787|Ga0315900_10893669 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031857|Ga0315909_10026716 | Not Available | 5685 | Open in IMG/M |
| 3300031857|Ga0315909_10094911 | All Organisms → Viruses → Predicted Viral | 2589 | Open in IMG/M |
| 3300031951|Ga0315904_10282520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1567 | Open in IMG/M |
| 3300031951|Ga0315904_10416906 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300031951|Ga0315904_10427921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1190 | Open in IMG/M |
| 3300031963|Ga0315901_11205819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300034018|Ga0334985_0718472 | Not Available | 538 | Open in IMG/M |
| 3300034023|Ga0335021_0260570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
| 3300034062|Ga0334995_0020439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5911 | Open in IMG/M |
| 3300034062|Ga0334995_0288736 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300034102|Ga0335029_0002164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15667 | Open in IMG/M |
| 3300034106|Ga0335036_0003299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13894 | Open in IMG/M |
| 3300034106|Ga0335036_0003457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13552 | Open in IMG/M |
| 3300034117|Ga0335033_0497459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300034166|Ga0335016_0112988 | All Organisms → Viruses → Predicted Viral | 1924 | Open in IMG/M |
| 3300034200|Ga0335065_0218098 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
| 3300034283|Ga0335007_0017648 | Not Available | 5650 | Open in IMG/M |
| 3300034283|Ga0335007_0204961 | Not Available | 1366 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.60% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.59% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.75% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.92% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.92% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.92% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.92% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.92% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_12036492 | 3300002195 | Lake | MKLTKRGKRVRAVFILIGLFAIWQVSMNLWWTEDGYCWGTMVECMLND* |
| JGI25911J50253_101051364 | 3300003411 | Freshwater Lake | MKLTKRGKRVRAVLILIGLWAIWQVSGHLWWVEDHYCWGEMVECYFPK* |
| JGI25925J51416_100425912 | 3300003497 | Freshwater Lake | MKLTKRGKRVRAVLILIGIWALWQISGHVWWVEDHYCWGEMVECYFPK* |
| JGI25930J51415_100214110 | 3300003499 | Freshwater Lake | MKLTKRGKRVRAVAILLGIIAIYYVMTHIWWVGDHYCWGSMVECYFEEGK* |
| Ga0066177_103070993 | 3300004096 | Freshwater Lake | MKLTKRGKRVRAVLILAAIATIYYVTLNVWWVGDGYCWGDMTECYLGDK* |
| Ga0066182_100118283 | 3300004125 | Freshwater Lake | MITKRGKRVRAVLILAATVAILYTSSHLWWVGDHYCWGDMVECYWETNE* |
| Ga0068877_100185898 | 3300005525 | Freshwater Lake | MKLTKRGKRVRAVLILAGIIALYYISTHLWWTGTGYCWGTGTECLLGGL* |
| Ga0068877_100293127 | 3300005525 | Freshwater Lake | MKLTKRGKRVRAVLILAGIIALYYVSTHLWWTGTGYCWGTITECFMGEL* |
| Ga0068876_105845182 | 3300005527 | Freshwater Lake | MKLTKRGKRVRAVLILAAAVAIYYITGHIWWVGDGYCWGTMTECFLGGK* |
| Ga0068872_106973301 | 3300005528 | Freshwater Lake | IMKLTKRGKRVRAVLILIGLFAIWQVSMNLWWTEDGYCWGTMVECMLDD* |
| Ga0079957_100044041 | 3300005805 | Lake | MKLTKRGKRVRAVFILIGLFAIWQVSMNLWWTEDGYCWGTMVKCMLDD* |
| Ga0070744_100610344 | 3300006484 | Estuarine | MKLTKRGKLVRAVLILIGLWAIWQVSGHLWWVEDHYCWGEMVECYFPK* |
| Ga0070744_100768461 | 3300006484 | Estuarine | MKLTKRGKRVRAVLILIGLWAIWQVSGHLWWVENHYCWGEMVECYFPK* |
| Ga0070744_102023381 | 3300006484 | Estuarine | RGKRVRAVLILIGLWTIWQVSMNLWWTDGGYCWGTMVECMLDD* |
| Ga0079301_10013154 | 3300006639 | Deep Subsurface | MKLTKRGKRVRAVLILIGLWAWWKISGNLWWVEDHYCWGEMVECYFPK* |
| Ga0070749_1000287011 | 3300006802 | Aqueous | MKLTKRGKRVRAVAILLGIIAIYYVMNHIWWVGDHYCWGSMVECYFEEGK* |
| Ga0079302_10696712 | 3300007165 | Deep Subsurface | MKLTKRGKRVRAVLILIGLWAWWQISGHLWWVEDHYCWGKMVECYFPK* |
| Ga0102978_11361787 | 3300007177 | Freshwater Lake | MKLTKRGKRVRAVAILLAIWAWWQISGHLWWVEDHYCWGTMTECFFGEK* |
| Ga0102692_15134555 | 3300007321 | Freshwater Lake | MKLTKRGKRVRAVTILAGIIALYYISTHLWWVGDHYCWGTLLECMPGEFNE* |
| Ga0104988_1090123 | 3300007735 | Freshwater | MKLTKRGKRVRAVFILIGLFVIWQVSMNLWWTEDGYCWGTMVECMLDD* |
| Ga0114340_10618997 | 3300008107 | Freshwater, Plankton | MKLTKRGKRVRAVVILLGIIAIYYVMNHIWWVGDHYCWGSMVECYFGEDK* |
| Ga0114346_13133242 | 3300008113 | Freshwater, Plankton | MKLTKRGKRVRAVLILIGLWAIWQVSMNLWWTEDGYCWGTMVECMLDD* |
| Ga0114350_100643521 | 3300008116 | Freshwater, Plankton | MKLTKRGKRVRAIFILIGLWAIWQVSMNLWWTDGGYCWGTMVECMLDD* |
| Ga0114350_10971431 | 3300008116 | Freshwater, Plankton | MKLTKRGKRVRAVLILIGLFAIWQVSMNLWWTEDGYCWGTMVECMLDD* |
| Ga0114354_11842463 | 3300008119 | Freshwater, Plankton | KRVRAIFILIGLWAIWQVSMNLWWTDGGYCWGTMVECMLDD* |
| Ga0114355_10298406 | 3300008120 | Freshwater, Plankton | MKLTKRGKRVRAVAILLGFVAVYYITSHIWWVEDHYCWGTMIECYFGEGK* |
| Ga0114355_11043705 | 3300008120 | Freshwater, Plankton | MKLTKRGKRVRAVFILIGLFAIWQVSMNLWWTEDGYCWGTMVECMLDD* |
| Ga0114353_13534142 | 3300008264 | Freshwater, Plankton | MKLTKRGKRVRAVLILIGLFAIWQVSMNLWWTEDGY |
| Ga0114363_10880742 | 3300008266 | Freshwater, Plankton | MKLTKRGKRVRAVAILFGIIAIYYITNNLWWVGDGYCWGDMVKCYEYGK* |
| Ga0114363_10985033 | 3300008266 | Freshwater, Plankton | MKLTKRGKRVRAVLILAAAVAIYYVTGHIWWVGDGYCWGTMTECFLGGK* |
| Ga0114363_11614392 | 3300008266 | Freshwater, Plankton | MKLTKRGKRVRAVLILAAVVAFYYVSSHVWWVGDGYCWGEMTECYWGDK* |
| Ga0114876_103093912 | 3300008448 | Freshwater Lake | MKLTRRGKQVRAVLILAVIAGAYLIATNLWWTGTDWCWGEMTECVL* |
| Ga0114880_10603201 | 3300008450 | Freshwater Lake | MKLTRRGKVVATVGILLVIWAIWQVSGNLWWVGDGYCWGPMTECMFGE |
| Ga0114880_11381322 | 3300008450 | Freshwater Lake | MKLTKRGKRVRALLILAGIIALYYVSTHVWWTGTSYCWGDLLECMPGEFNE* |
| Ga0114880_12765421 | 3300008450 | Freshwater Lake | MKLTKRGKRVRAVLILLGIWAWWQISGHLWWVEDHYCWGE |
| Ga0114973_1000124417 | 3300009068 | Freshwater Lake | MKLTKRGKQVRAVLILIGLWAIWQVSGHLWWVEDHYCWGEMVECYFPK* |
| Ga0114980_107710582 | 3300009152 | Freshwater Lake | MKLTKRGKRVRAVLILIGIWALWQISGHVWWVEDHYCWGTMLECYAGK* |
| Ga0114968_100724374 | 3300009155 | Freshwater Lake | MKLTKRGKQVRAVLILIGLWAIWQVSGHLWWVEDHYCWGEMVECFFPK* |
| Ga0114968_105349681 | 3300009155 | Freshwater Lake | RVRAILILAAIATIYYITLNVWWVGDGYCWGDMTECYLGDK* |
| Ga0114978_100520718 | 3300009159 | Freshwater Lake | MKLTKRGKRVRAVLILIGIWALWQISGHVWWVEDHYCWGEMVECYFPE* |
| Ga0114978_100634954 | 3300009159 | Freshwater Lake | MKLTKRGKRVRAVAIILGIAFILWVISNLWWVGDGYCWGSMIECNFPEKGGK* |
| Ga0114978_104261514 | 3300009159 | Freshwater Lake | MKLTKRGKRVRAVLILIGIWALWQISSHVWWVEDHYCWGTMLECYAGK* |
| Ga0114976_102161294 | 3300009184 | Freshwater Lake | MITKRGKRVRAVAILLGAWGVWWLTGHNWWVGDHYCWGDMIECYWEGK* |
| Ga0129333_105590121 | 3300010354 | Freshwater To Marine Saline Gradient | MKLTKRGKRVRAVAILLGIIAIYYVMTHIWWVGDHYCWGSMVECYFGEDK* |
| Ga0133913_106406513 | 3300010885 | Freshwater Lake | MKLTKRGKRVRAVAIILGIAFILWVISNLWWVGNGYCWGSMNECYFPQLEGNK* |
| Ga0133913_113548667 | 3300010885 | Freshwater Lake | MITKRGKQVRAVAILLSVWGVWWLTGHIWWVGDHYCWGDMIECYWEGK* |
| Ga0151517_160224 | 3300011113 | Freshwater | MKLTKRGKRVRAVLILIGLFVIWQVSMNLWWTEDGYCWGTMVECMLDD* |
| Ga0164292_102103561 | 3300013005 | Freshwater | MKLTKRGKRVRAVLILIVLWAIWQVSMNLWWTEDGYCWGTMVECM |
| Ga0177922_100046022 | 3300013372 | Freshwater | MKLTKRGKRVRAVFILVAIVATWQVMGHLWWVGDGYCWGGMTECMLGDK* |
| Ga0181364_10556211 | 3300017701 | Freshwater Lake | MKLTKRGKRVRAVLILAATVAILYTSSHLWWVGDHYCWGDMVECY |
| Ga0181364_10562011 | 3300017701 | Freshwater Lake | MITKRGKRVRAVLILAATVAILYTSSHLWWVGDHYCWGDMVECY |
| Ga0181347_10960843 | 3300017722 | Freshwater Lake | MKLTKRGKQVRAVLILIGIWALWQISGHVWWVEDHYCWGEMVECYFPK |
| Ga0181362_10128931 | 3300017723 | Freshwater Lake | MKLTKRGKQVRAVLILIALWAIWQVSGHLWWVEDHYCWGEMVKCYFPK |
| Ga0181358_12584422 | 3300017774 | Freshwater Lake | MKLTKRGKRVRAILILAAIATIYYITLNVWWVGDGYCWGDMTECYLGDK |
| Ga0181357_12275881 | 3300017777 | Freshwater Lake | NMKLTKRGKQVRAVLILIGIWALWQISGHVWWVEDHYCWGEMVECYFPK |
| Ga0181355_13494751 | 3300017785 | Freshwater Lake | TDFNGEGDTMITRRGKLVRAVLILAATVAVLYTTTHLWWVGDHYCWGDMVQCYLGDK |
| Ga0181361_1001763 | 3300019783 | Freshwater Lake | MKLTKRGKRVRAVLILAAIATIYYVTLNVWWVGDGYCWGDMTECYLGDK |
| Ga0181361_1013753 | 3300019783 | Freshwater Lake | MKLTKRGKRVRAVLILAAIATIYYVTLNVWWVGDGYCWGGMTECMLGDK |
| Ga0181359_10141498 | 3300019784 | Freshwater Lake | MKLTKRGKRVRAVAILLGIIAIYYVMTHIWWVGDHYCWGSMVECYFEEGK |
| Ga0181359_10228739 | 3300019784 | Freshwater Lake | MITRRGKLVRAVLILAATVAVLYTTTHLWWVGDHYCWGDMVQCYLGDK |
| Ga0181359_11497733 | 3300019784 | Freshwater Lake | MKLTKRGKRVRAILILVAAVAIYYITSHIWWVGDGYCWGDMTECYLGDK |
| Ga0211734_101552464 | 3300020159 | Freshwater | MKLTKRGKRVRAILILIALWSIWKVSGHLWWVEDHYCWGEMVECYFPK |
| Ga0211731_1089729428 | 3300020205 | Freshwater | MKLTKRGKRVRAVAILAAAVAIWYVSGHVWWVGDHYCWGTMTECFLGKE |
| Ga0208855_10287551 | 3300020553 | Freshwater | RAIFILIGLWAIWQVSMNLWWTDGGYCWGTMVECMLDD |
| Ga0208599_10538141 | 3300020554 | Freshwater | AMKLTKRGKRVRAIFILIGLWAIWQVSMNLWWTDGGYCWGTMVECMLDD |
| Ga0194117_101309441 | 3300021424 | Freshwater Lake | MKLTKRGKRVRAVAILLGIVAVYYITSHIWWVGDHYCWGDMISCYFEEGK |
| Ga0222713_103855923 | 3300021962 | Estuarine Water | MKLTKRGKRVRAVFILIGLFVIWQVSMNLWWTEDGYCWGTMVECMLDD |
| Ga0181351_10611973 | 3300022407 | Freshwater Lake | MKLTKRGKRVRAVLILAATVAILYTSSHLWWVGDHYCWGDMVECYWETNE |
| Ga0181351_11010222 | 3300022407 | Freshwater Lake | MKLTKRGKRVRAVLILIGIWALWQISGHVWWVEDHYCWGEMVECYFPK |
| Ga0214917_1001072411 | 3300022752 | Freshwater | MKLTKRGKRVRAVLILIGLFAIWQVSMNLWWTEDGYCWGTMVECMLDD |
| Ga0214917_100446998 | 3300022752 | Freshwater | MKLTKRGKRVRAVAILAGIIALYYISTHLWWVGDHYCWGTLLECMPGEFNE |
| Ga0214921_1002510811 | 3300023174 | Freshwater | MKLTKRGKRVRAIAIFIGIWAIYMIATHLWWTGSGYCWGSMVECVKL |
| Ga0208009_100003359 | 3300027114 | Deep Subsurface | MKLTKRGKRVRAVLILIGLWAWWKISGNLWWVEDHYCWGEMVECYFPK |
| Ga0209552_10234985 | 3300027563 | Freshwater Lake | MITKRGKRVRAVLILAATVAILYTSSHLWWVGDHYCWGDMVECYWETNE |
| Ga0208974_11786821 | 3300027608 | Freshwater Lentic | LKMKLTKRGKRVRAVLILIGLFAIWQVSMNLWWTEDGYCWGTMVECMLDD |
| Ga0209596_10552433 | 3300027754 | Freshwater Lake | MKLTKRGKQVRAVLILIGLWAIWQVSGHLWWVEDHYCWGEMVECFFPK |
| Ga0209296_101573111 | 3300027759 | Freshwater Lake | MITKRGKRVRAVFIVLAIYAGFKITGNIWWVGDHYCWGSMTECVLGGK |
| Ga0209088_1000027622 | 3300027763 | Freshwater Lake | MKLTKRGKRVRAVLILIGIWALWQISSHVWWVEDHYCWGTMLECYAGK |
| Ga0209088_100156675 | 3300027763 | Freshwater Lake | MKLTKRGKRVRAVAIILGIAFILWVISNLWWVGDGYCWGSMIECNFPEKGGK |
| Ga0209500_103871073 | 3300027782 | Freshwater Lake | MKLTKRGKRVRAVLILIGIWALWQISSHVWWVEDHYC |
| Ga0209972_1000103228 | 3300027793 | Freshwater Lake | MKLTKRGKRVRAVTILAGIIALYYISTHLWWVGDHYCWGTLLECMPGEFNE |
| Ga0209400_100823712 | 3300027963 | Freshwater Lake | MKLTKRGKQVRAVLILIGLWAIWQVSGHLWWVEDHYCWGEMVECYFPK |
| Ga0209400_12991602 | 3300027963 | Freshwater Lake | MKLTKRGKRVRAVLILIGLWAIWQVSGHVWWVEDHYCWGEMVECYFPK |
| Ga0209298_100072951 | 3300027973 | Freshwater Lake | MKLTKRGKRVRAVLILIGLWGIWQVSGHLWWVEDHYCWGEMVECYFPK |
| Ga0209298_1001685210 | 3300027973 | Freshwater Lake | KMKLTKRGKRVRAVLILIGLWAIWQVSGHLWWVEDHYCWGEMVECYFPK |
| Ga0247723_100285111 | 3300028025 | Deep Subsurface Sediment | MKLTKRGKRVRAVLILIGLWAWWQISGHLWWVEDHYCWGEMVECYFPK |
| (restricted) Ga0247844_11432704 | 3300028571 | Freshwater | MKLTKRGKRVRAIAILLGLVAIYFIVNNIWWTGTNYCWGNID |
| Ga0315907_100314032 | 3300031758 | Freshwater | MKLTKRGKRVRAIFILIGLWAIWQVSMNLWWTDGGYCWGTMVECMLDD |
| Ga0315907_100685386 | 3300031758 | Freshwater | MKLTKRGKRVRAVLILAGIIALYYVSTHLWWTGTGYCWGTITECFMGEL |
| Ga0315907_112204972 | 3300031758 | Freshwater | MKLTRRGKVVATVGILLVIWAIWQVSGNLWWVGDGYCWGPMTECMFGEK |
| Ga0315900_108936693 | 3300031787 | Freshwater | MKLTKRGKRVRAVFILIGLFAIWQVSMNLWWTEDGY |
| Ga0315909_100267161 | 3300031857 | Freshwater | MKLTKRGKRVRAVAILLGFVAVYYITSHIWWVEDHYCWGTMIECYFGEGK |
| Ga0315909_1009491112 | 3300031857 | Freshwater | MKLTKRGKRVRAVLILAAAVAIYYVTGHIWWVGDGYCWGTMTECFLGGK |
| Ga0315904_102825207 | 3300031951 | Freshwater | MKLTKRGKRVRAVLILAGIIALYYISTHLWWTGTGYCWGTGTECLLGGL |
| Ga0315904_104169061 | 3300031951 | Freshwater | MKLTKRGKRVRAVVILLGIIAIYYVMNHIWWVGDHYCWGSMVECYFGEDK |
| Ga0315904_104279215 | 3300031951 | Freshwater | MKLTKRGKRVRAVLILAGIIALYYISTHLWWTGTGYCWGT |
| Ga0315901_112058192 | 3300031963 | Freshwater | MKLTKRGKRVRAVAILFGIIAIYYITNNLWWVGDGYCWGDMVKCYEYGK |
| Ga0334985_0718472_1_123 | 3300034018 | Freshwater | RVRAVLILIGLFAIWQVSMNLWWTEDGYCWGTMVECMLDD |
| Ga0335021_0260570_3_155 | 3300034023 | Freshwater | LVMKLTKRGKRVRAVLILIGLWAIWQVSMNLWWTEDGYCWGTMVECMLDD |
| Ga0334995_0020439_2945_3094 | 3300034062 | Freshwater | MKLTKRGKRVRAVAILAAAVAIWYVSGRVWWVGDHYCWGTMTECFLGKE |
| Ga0334995_0288736_942_1079 | 3300034062 | Freshwater | TKRGKRVRAVLILIGLFAIWQVSMNLWWTEDGYCWGTMVECMLDD |
| Ga0335029_0002164_12792_12941 | 3300034102 | Freshwater | MKLTKRGKRVRAVAILLAVLAIWQISGHLWWVGDGYCWGTMTECFLGGR |
| Ga0335036_0003299_4778_4927 | 3300034106 | Freshwater | MKLTKRGKRVRAVLILAAVVAFYYVSSHVWWVGDGYCWGEMIECYWGDK |
| Ga0335036_0003457_1483_1632 | 3300034106 | Freshwater | MKLTKRGKRVRAVLILAAVVAFYYVSSHVWWVGDGYCWGEITECYWGDK |
| Ga0335033_0497459_3_143 | 3300034117 | Freshwater | MKLTKRGKRVRAVFILVAIVATWQVMGHLWWVGDGYCWGDMTECMLG |
| Ga0335016_0112988_3_116 | 3300034166 | Freshwater | ALLILIGLLAIWQVSMNLWWTEDGYCWGTMVECMLDD |
| Ga0335065_0218098_75_224 | 3300034200 | Freshwater | MKLTKRGKRVRAVLILAAVVAFYYVSSHVWWVGDGYCWGEMTECYWGDK |
| Ga0335007_0017648_693_839 | 3300034283 | Freshwater | MKLTKRGKRVRAIFILIGLWAIWQVSMNLWWTDGGYCWGTMLECMLDD |
| Ga0335007_0204961_482_637 | 3300034283 | Freshwater | MKLTKRGKRVRAVAIILGIAFILWVISNLWWVGNGYCWGSMIECYFPEGRG |
| ⦗Top⦘ |