


| Basic Information | |
|---|---|
| Family ID | F088822 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDAMVK |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 57.80 % |
| % of genes near scaffold ends (potentially truncated) | 27.52 % |
| % of genes from short scaffolds (< 2000 bps) | 77.98 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.037 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (22.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.651 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.11% β-sheet: 0.00% Coil/Unstructured: 41.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01510 | Amidase_2 | 7.34 |
| PF16778 | Phage_tail_APC | 5.50 |
| PF13539 | Peptidase_M15_4 | 5.50 |
| PF00959 | Phage_lysozyme | 1.83 |
| PF08281 | Sigma70_r4_2 | 1.83 |
| PF08299 | Bac_DnaA_C | 1.83 |
| PF07460 | NUMOD3 | 0.92 |
| PF00386 | C1q | 0.92 |
| PF00622 | SPRY | 0.92 |
| PF11651 | P22_CoatProtein | 0.92 |
| PF11160 | Hva1_TUDOR | 0.92 |
| PF11351 | GTA_holin_3TM | 0.92 |
| PF12651 | RHH_3 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.96 % |
| Unclassified | root | N/A | 44.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000418|P_2C_Liq_1_UnCtyDRAFT_1002779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. AzwK-3b | 5818 | Open in IMG/M |
| 3300000418|P_2C_Liq_1_UnCtyDRAFT_1018148 | Not Available | 1534 | Open in IMG/M |
| 3300000418|P_2C_Liq_1_UnCtyDRAFT_1068255 | Not Available | 595 | Open in IMG/M |
| 3300000418|P_2C_Liq_1_UnCtyDRAFT_1084478 | Not Available | 516 | Open in IMG/M |
| 3300000947|BBAY92_10024254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1651 | Open in IMG/M |
| 3300000947|BBAY92_12253321 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300003216|JGI26079J46598_1077224 | Not Available | 627 | Open in IMG/M |
| 3300003216|JGI26079J46598_1108034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300003427|JGI26084J50262_1017279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2410 | Open in IMG/M |
| 3300003427|JGI26084J50262_1043517 | Not Available | 1116 | Open in IMG/M |
| 3300004829|Ga0068515_100690 | Not Available | 4331 | Open in IMG/M |
| 3300004829|Ga0068515_107096 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300005512|Ga0074648_1075540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1295 | Open in IMG/M |
| 3300005512|Ga0074648_1087901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1138 | Open in IMG/M |
| 3300005512|Ga0074648_1134504 | Not Available | 783 | Open in IMG/M |
| 3300005590|Ga0070727_10019781 | All Organisms → cellular organisms → Bacteria | 4462 | Open in IMG/M |
| 3300006025|Ga0075474_10092319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 984 | Open in IMG/M |
| 3300006025|Ga0075474_10206268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 601 | Open in IMG/M |
| 3300006026|Ga0075478_10151356 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006027|Ga0075462_10000375 | Not Available | 13665 | Open in IMG/M |
| 3300006027|Ga0075462_10207614 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 588 | Open in IMG/M |
| 3300006637|Ga0075461_10019771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2225 | Open in IMG/M |
| 3300006793|Ga0098055_1341332 | Not Available | 557 | Open in IMG/M |
| 3300006802|Ga0070749_10029028 | All Organisms → cellular organisms → Bacteria | 3464 | Open in IMG/M |
| 3300006802|Ga0070749_10042009 | All Organisms → Viruses → Predicted Viral | 2809 | Open in IMG/M |
| 3300006802|Ga0070749_10276435 | Not Available | 946 | Open in IMG/M |
| 3300006802|Ga0070749_10547306 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006867|Ga0075476_10189424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 753 | Open in IMG/M |
| 3300006868|Ga0075481_10143211 | Not Available | 873 | Open in IMG/M |
| 3300007539|Ga0099849_1209004 | Not Available | 731 | Open in IMG/M |
| 3300007541|Ga0099848_1024861 | All Organisms → Viruses → Predicted Viral | 2528 | Open in IMG/M |
| 3300007541|Ga0099848_1229389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 656 | Open in IMG/M |
| 3300008012|Ga0075480_10038665 | All Organisms → Viruses → Predicted Viral | 2854 | Open in IMG/M |
| 3300008012|Ga0075480_10369360 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300009000|Ga0102960_1000148 | Not Available | 24981 | Open in IMG/M |
| 3300009001|Ga0102963_1041166 | All Organisms → Viruses → Predicted Viral | 1919 | Open in IMG/M |
| 3300009001|Ga0102963_1086517 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300009001|Ga0102963_1106428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1142 | Open in IMG/M |
| 3300009001|Ga0102963_1156349 | Not Available | 917 | Open in IMG/M |
| 3300009001|Ga0102963_1306914 | Not Available | 624 | Open in IMG/M |
| 3300009124|Ga0118687_10213958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 706 | Open in IMG/M |
| 3300009124|Ga0118687_10278619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 625 | Open in IMG/M |
| 3300010149|Ga0098049_1030122 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
| 3300010299|Ga0129342_1182871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 751 | Open in IMG/M |
| 3300010300|Ga0129351_1109384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1106 | Open in IMG/M |
| 3300016749|Ga0182053_1020910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 862 | Open in IMG/M |
| 3300017727|Ga0181401_1007847 | Not Available | 3518 | Open in IMG/M |
| 3300017762|Ga0181422_1066748 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300017782|Ga0181380_1238880 | Not Available | 604 | Open in IMG/M |
| 3300017783|Ga0181379_1020825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2653 | Open in IMG/M |
| 3300017783|Ga0181379_1102873 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300017813|Ga0188953_10023 | All Organisms → cellular organisms → Bacteria | 14613 | Open in IMG/M |
| 3300017824|Ga0181552_10043470 | Not Available | 2673 | Open in IMG/M |
| 3300017950|Ga0181607_10576179 | Not Available | 594 | Open in IMG/M |
| 3300017951|Ga0181577_10007911 | Not Available | 8014 | Open in IMG/M |
| 3300017951|Ga0181577_10104025 | All Organisms → Viruses → Predicted Viral | 1965 | Open in IMG/M |
| 3300017951|Ga0181577_10823818 | Not Available | 558 | Open in IMG/M |
| 3300017957|Ga0181571_10423637 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 822 | Open in IMG/M |
| 3300017960|Ga0180429_10691283 | Not Available | 687 | Open in IMG/M |
| 3300017967|Ga0181590_10337826 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1085 | Open in IMG/M |
| 3300017991|Ga0180434_11071864 | Not Available | 604 | Open in IMG/M |
| 3300018410|Ga0181561_10298230 | Not Available | 751 | Open in IMG/M |
| 3300018420|Ga0181563_10205458 | Not Available | 1198 | Open in IMG/M |
| 3300018424|Ga0181591_11116152 | Not Available | 530 | Open in IMG/M |
| 3300019756|Ga0194023_1005081 | All Organisms → Viruses → Predicted Viral | 2639 | Open in IMG/M |
| 3300019765|Ga0194024_1046623 | Not Available | 957 | Open in IMG/M |
| 3300020166|Ga0206128_1004410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10998 | Open in IMG/M |
| 3300021379|Ga0213864_10151150 | Not Available | 1172 | Open in IMG/M |
| 3300021425|Ga0213866_10200853 | Not Available | 1035 | Open in IMG/M |
| 3300021958|Ga0222718_10084837 | All Organisms → Viruses → Predicted Viral | 1901 | Open in IMG/M |
| 3300021958|Ga0222718_10487853 | Not Available | 598 | Open in IMG/M |
| 3300021958|Ga0222718_10538405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 558 | Open in IMG/M |
| 3300021959|Ga0222716_10185382 | Not Available | 1330 | Open in IMG/M |
| 3300021959|Ga0222716_10261780 | Not Available | 1062 | Open in IMG/M |
| 3300021959|Ga0222716_10483701 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300021959|Ga0222716_10599573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 602 | Open in IMG/M |
| 3300021960|Ga0222715_10429250 | Not Available | 716 | Open in IMG/M |
| 3300021960|Ga0222715_10456897 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300021960|Ga0222715_10513617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300021960|Ga0222715_10516643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 631 | Open in IMG/M |
| 3300021964|Ga0222719_10042901 | All Organisms → Viruses → Predicted Viral | 3486 | Open in IMG/M |
| 3300021964|Ga0222719_10423153 | Not Available | 822 | Open in IMG/M |
| 3300022065|Ga0212024_1022359 | Not Available | 1038 | Open in IMG/M |
| 3300022065|Ga0212024_1057472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300022198|Ga0196905_1171247 | Not Available | 552 | Open in IMG/M |
| 3300022922|Ga0255779_1153420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1077 | Open in IMG/M |
| 3300022923|Ga0255783_10391079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 525 | Open in IMG/M |
| 3300022937|Ga0255770_10014319 | Not Available | 5928 | Open in IMG/M |
| 3300023115|Ga0255760_10346510 | Not Available | 710 | Open in IMG/M |
| 3300024301|Ga0233451_10208122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 826 | Open in IMG/M |
| 3300024301|Ga0233451_10226484 | Not Available | 773 | Open in IMG/M |
| 3300024319|Ga0228670_1003290 | Not Available | 5532 | Open in IMG/M |
| 3300025608|Ga0209654_1039521 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
| 3300025617|Ga0209138_1092378 | Not Available | 910 | Open in IMG/M |
| 3300025617|Ga0209138_1183174 | Not Available | 500 | Open in IMG/M |
| 3300025636|Ga0209136_1008734 | Not Available | 4748 | Open in IMG/M |
| 3300025636|Ga0209136_1052412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1362 | Open in IMG/M |
| 3300025645|Ga0208643_1057263 | All Organisms → Viruses → unclassified viruses → Skeletonema virus LDF-2015a | 1174 | Open in IMG/M |
| 3300025652|Ga0208134_1096568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300025671|Ga0208898_1017713 | All Organisms → Viruses → Predicted Viral | 3260 | Open in IMG/M |
| 3300025695|Ga0209653_1009414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5375 | Open in IMG/M |
| 3300025701|Ga0209771_1184715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 615 | Open in IMG/M |
| 3300025769|Ga0208767_1275379 | Not Available | 509 | Open in IMG/M |
| 3300025880|Ga0209534_10130646 | Not Available | 1365 | Open in IMG/M |
| 3300025886|Ga0209632_10228036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 966 | Open in IMG/M |
| 3300027612|Ga0209037_1101856 | Not Available | 701 | Open in IMG/M |
| 3300029308|Ga0135226_1004855 | Not Available | 865 | Open in IMG/M |
| 3300029345|Ga0135210_1002329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
| 3300034375|Ga0348336_199770 | Not Available | 535 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.94% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 15.60% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 11.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 11.01% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 5.50% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.59% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 3.67% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.75% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.83% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.83% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.83% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 1.83% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 1.83% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.83% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.83% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.83% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.92% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Saline Water | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000418 | Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300016749 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017813 | Saline water viral communities from Saloum River inverse estuary, Senegal ? P2 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300029308 | Marine harbor viral communities from the Indian Ocean - SRB2 | Environmental | Open in IMG/M |
| 3300029345 | Marine harbor viral communities from the Indian Ocean - SCH1 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P_2C_Liq_1_UnCtyDRAFT_10027796 | 3300000418 | Enviromental | MDQKAIISVLFASVMGLIGWNINTTNELQLAVQRLEIILLSDGMSK* |
| P_2C_Liq_1_UnCtyDRAFT_10181482 | 3300000418 | Enviromental | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLSDGMSK* |
| P_2C_Liq_1_UnCtyDRAFT_10682552 | 3300000418 | Enviromental | MDQKAIISVLFAAVMGLMGWNIQTTNDLQLAVQRLEIILLDDGMSK* |
| P_2C_Liq_1_UnCtyDRAFT_10844782 | 3300000418 | Enviromental | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLDDAMAK* |
| BBAY92_100242543 | 3300000947 | Macroalgal Surface | MDTKTIISVLFAAVVGLIGWNIKTTNELQISVARLEYILLNDAMTK* |
| BBAY92_122533212 | 3300000947 | Macroalgal Surface | MDNKAVVSIMSAALIGLLGWNIKTTNELQLSVQRLEIVLLHDAFTK* |
| JGI26079J46598_10772242 | 3300003216 | Marine | MDQKTIISVLFAAVMGLMGWNIKTTNELQLAVQRLEIILLDDGMSK* |
| JGI26079J46598_11080343 | 3300003216 | Marine | MDQKAIISVLFAAVMGLMGWNIKTTNELQLAVQRLEIILL |
| JGI26084J50262_10172793 | 3300003427 | Marine | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDGMSK* |
| JGI26084J50262_10435172 | 3300003427 | Marine | MDWVKPIISILFAAVVSLIAWNIKTTNDLQLKITRMEVILQNIAMEN* |
| Ga0068515_1006907 | 3300004829 | Marine Water | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDAMIK* |
| Ga0068515_1070963 | 3300004829 | Marine Water | MDSKTIISVLFAAVIGLIGWNIKTTNELQLAVQRLEIILLDDAMTK* |
| Ga0074648_10755402 | 3300005512 | Saline Water And Sediment | MDTKTIISVLFAAVIGLIGWNIKTTNELQLQVQRLEIILLDDAMTK* |
| Ga0074648_10879014 | 3300005512 | Saline Water And Sediment | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDAMTK* |
| Ga0074648_11345041 | 3300005512 | Saline Water And Sediment | MDQKAIISVLFAAVVALIGWNIKTTNDLQLQVQRLEIILLNDALVK* |
| Ga0070727_100197816 | 3300005590 | Marine Sediment | MDQKLVTTIVFGALLSLIGWNIKTTNDLQLTVARMEMLLRADALEK* |
| Ga0075474_100923193 | 3300006025 | Aqueous | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDAMVK* |
| Ga0075474_102062683 | 3300006025 | Aqueous | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDA |
| Ga0075478_101513562 | 3300006026 | Aqueous | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDALVK* |
| Ga0075462_100003758 | 3300006027 | Aqueous | MDQKAVISVLFAAIMGLIGWNIKTTNELQLRVQRLEIILLNDAFIK* |
| Ga0075462_102076142 | 3300006027 | Aqueous | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDALVK* |
| Ga0075461_100197713 | 3300006637 | Aqueous | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDAMTK* |
| Ga0098055_13413322 | 3300006793 | Marine | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDGMAK* |
| Ga0070749_100290289 | 3300006802 | Aqueous | MDQKTIISVLFAAIIGLIGWNIKTTHELTISVSKLEYILLQDAMAK* |
| Ga0070749_100420093 | 3300006802 | Aqueous | MEGKAIIGVLVAALMALATWNLKTTHDLTLAVQRLEIILLNDAMLK* |
| Ga0070749_102764353 | 3300006802 | Aqueous | MDQKAIISVLFAAVIGLIGWNIKTTNELQLAVQRLEIILLNDAMIK* |
| Ga0070749_105473061 | 3300006802 | Aqueous | ISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDALVK* |
| Ga0075476_101894241 | 3300006867 | Aqueous | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIIL |
| Ga0075481_101432111 | 3300006868 | Aqueous | QKAIISVLFAAVVALIGWNIKTTNDLQLQVQRLEIILLNDAFAK* |
| Ga0099849_12090043 | 3300007539 | Aqueous | VVSAVDQKAIMTVLFAAVISLIGWNIKTTNDLQLSVQRLEILLRADAMEN* |
| Ga0099848_10248614 | 3300007541 | Aqueous | MEQKAIISVLFAAITAMIGWDIKTTNDLQLRVQRLEIILLNDAFTK* |
| Ga0099848_12293893 | 3300007541 | Aqueous | ASTKMDTKTIISVLFAAVIGLIGWNIKTTNELQLQV* |
| Ga0075480_100386658 | 3300008012 | Aqueous | MDQKAIISVLFAAVMGLIGWDIKTTNELQLAVQRLEIILLNDALVK* |
| Ga0075480_103693603 | 3300008012 | Aqueous | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEI |
| Ga0102960_100014828 | 3300009000 | Pond Water | MDQKAIISVLFAAVMGLIGWNIKTTNDLQLAVQRLEIILLNDAMIK* |
| Ga0102963_10411667 | 3300009001 | Pond Water | ELMDQKAIISVLFAAVMGLIGWNIKTTNDLQLAVQRLEIILLNDAMIK* |
| Ga0102963_10865173 | 3300009001 | Pond Water | MDQKAIISVLFAATVGLIGWNIKTTNELQLQVQRLEIILLNDAFAK* |
| Ga0102963_11064281 | 3300009001 | Pond Water | MDQKVIISVLFAATVGLIGWNIKTTHELTISVSKLEFILLQDAMV |
| Ga0102963_11563492 | 3300009001 | Pond Water | MDQKSIISVLFAAIIGLIAWNIKTTHELTISVSKLEFILLQDAMVK* |
| Ga0102963_13069141 | 3300009001 | Pond Water | SVLFAATIGLIAWNIKTTHELTISVSKLEFILLQDAMVK* |
| Ga0118687_102139583 | 3300009124 | Sediment | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDALAK* |
| Ga0118687_102786192 | 3300009124 | Sediment | MDQKAIISVLFAAVIGLIGWNIKTTNDLQLAVQRLEIILLNDAMIK* |
| Ga0098049_10301224 | 3300010149 | Marine | MDNKALVSVLFAAVVGLIGWNINTTNQLQLQVQRLEIILLDDAFAK* |
| Ga0129342_11828711 | 3300010299 | Freshwater To Marine Saline Gradient | MDQKAIISVLFAAVVALIGWNIKTTNDLQLQVQRLEIILL |
| Ga0129351_11093841 | 3300010300 | Freshwater To Marine Saline Gradient | KAIISVLFAAVVALIGWNIKTTNDLQLQVQRLEIILLNDAFAK* |
| Ga0182053_10209104 | 3300016749 | Salt Marsh | MDPKVIISVLFAATVGLIGWNIKTTHELTISVSKLEFILLQDALVK |
| Ga0181401_10078473 | 3300017727 | Seawater | MSVLFAAVVALIGWNIKTTNDLQLQVQRLEIILLNDALVK |
| Ga0181422_10667482 | 3300017762 | Seawater | MDQKAIISVLFASVMGLVGWNIKTTNELQLSVQRLEIILLNDALVK |
| Ga0181380_12388803 | 3300017782 | Seawater | MDQKAIISVFFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDALVK |
| Ga0181379_10208253 | 3300017783 | Seawater | MSVLFAAVVALIGWNIKTTNDLQLQVQRLEIILLNDALMK |
| Ga0181379_11028735 | 3300017783 | Seawater | MDQKAIISVLFASVMGLVGWNIKTTNELQLSVQRLEIILLNDALV |
| Ga0188953_1002315 | 3300017813 | Saline Water | MEKSIISVLIAAMVALIGWNIKTTNELQLAVQRLEILLRADAMEN |
| Ga0181552_100434705 | 3300017824 | Salt Marsh | MDQKVIISVLFAATVGLIGWNIKTTHELTISVSKLEFILLQDALVK |
| Ga0181607_105761791 | 3300017950 | Salt Marsh | DQKVIVSVLFAAVIGLIGWNIKTTHELTISVSKLEFILLQDAMVK |
| Ga0181577_1000791123 | 3300017951 | Salt Marsh | MDQKAIISVLFAATIGLIAWNIKTTHELTISVSKLEFILLQDAMVK |
| Ga0181577_101040252 | 3300017951 | Salt Marsh | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDALVK |
| Ga0181577_108238181 | 3300017951 | Salt Marsh | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDAMTK |
| Ga0181571_104236372 | 3300017957 | Salt Marsh | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDALVK |
| Ga0180429_106912833 | 3300017960 | Hypersaline Lake Sediment | MEKTLLPILFAAVVGLIGWNIKTTNELQITVARLEIILNAIAMEN |
| Ga0181590_103378263 | 3300017967 | Salt Marsh | VDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDALVK |
| Ga0180434_110718642 | 3300017991 | Hypersaline Lake Sediment | VSAVDQKAIMTVLFAAVISLIGWNIKTTNDLQLSVQRLEILLRADAMEN |
| Ga0181561_102982302 | 3300018410 | Salt Marsh | DQKVIISVLFAATVGLIGWNIKTTHELTISVSKLEFILLQDALVK |
| Ga0181563_102054582 | 3300018420 | Salt Marsh | MDQKSIISVLFAAIIGLIAWNIKTTHELTISVSKLEFILLQDAMVK |
| Ga0181591_111161522 | 3300018424 | Salt Marsh | MDPKTIISVLFAAIIGLIGWNIKTTHELTISVSKLEFILLQDAMVK |
| Ga0194023_10050815 | 3300019756 | Freshwater | MDQKAIISVLFAAVIGLIGWNIKTTNELQLAVQRLEIILLNDAMIK |
| Ga0194024_10466234 | 3300019765 | Freshwater | MDQKAVISVLFAAIMGLIGWNIKTTNELQLQVQRLEIILLNDAFTK |
| Ga0206128_100441011 | 3300020166 | Seawater | VDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLDDAMAK |
| Ga0213864_101511504 | 3300021379 | Seawater | MDQKAIISVLFAAVVALIGWNIKTTHELTLQVQKLEVILLNDAFAK |
| Ga0213866_102008534 | 3300021425 | Seawater | MMDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLND |
| Ga0222718_100848374 | 3300021958 | Estuarine Water | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDALAK |
| Ga0222718_104878532 | 3300021958 | Estuarine Water | KAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLDDAMAK |
| Ga0222718_105384051 | 3300021958 | Estuarine Water | MDQKAIISVLFAAVMGLIGWNIKTTNDLQLAVQRLEIILLNDAMIK |
| Ga0222716_101853822 | 3300021959 | Estuarine Water | MDQKAVISVLFAAIMGLIGWNIKTTNELQLRVQRLEIILLNDAFTK |
| Ga0222716_102617803 | 3300021959 | Estuarine Water | MDTNTMISVLFAAVVRLIGWNIKTTNELQISVARLEYILLNDATAK |
| Ga0222716_104837013 | 3300021959 | Estuarine Water | MDQRAVISVLFAAITAMIGWDIKTTNDLQLRVQRLEIILLNDAFIK |
| Ga0222716_105995733 | 3300021959 | Estuarine Water | AAVMGLIGWNIKTTNELQLSVQRLEIILLNDAMVK |
| Ga0222715_104292502 | 3300021960 | Estuarine Water | MDQKVIISVLFAAVIGLIGWNIKTTHELTISVSKLEFILLQDAMVK |
| Ga0222715_104568972 | 3300021960 | Estuarine Water | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDAMIK |
| Ga0222715_105136171 | 3300021960 | Estuarine Water | MDQKVIISVLFAATVGLIGWNIKTTHELTISVSKLEFILLQDAMVK |
| Ga0222715_105166432 | 3300021960 | Estuarine Water | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDAMVK |
| Ga0222719_100429015 | 3300021964 | Estuarine Water | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLDDALAK |
| Ga0222719_104231532 | 3300021964 | Estuarine Water | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLSDALVK |
| Ga0212024_10223593 | 3300022065 | Aqueous | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLNDAMTK |
| Ga0212024_10574722 | 3300022065 | Aqueous | MDQKAVISVLFAAIMGLIGWNIKTTNELQLRVQRLEIILLNDAFIK |
| Ga0196905_11712472 | 3300022198 | Aqueous | MEQKAIISVLFAAITAMIGWDIKTTNDLQLRVQRLEIILLNDAFTK |
| Ga0255779_11534201 | 3300022922 | Salt Marsh | MDQKVIISVLFAATVGLIGWNIKTTHELTISVSKLE |
| Ga0255783_103910791 | 3300022923 | Salt Marsh | MDPKVIISVLFAATVGLIGWNIKTTHELTISVSKLEFILLQDAL |
| Ga0255770_1001431912 | 3300022937 | Salt Marsh | MEKSILPILIAALVSLIGWNIKTTNDLQLSVQRLEI |
| Ga0255760_103465103 | 3300023115 | Salt Marsh | ILPILIAALVSLIGWNIKTTNDLQLSVQRLEILLRADAMEN |
| Ga0233451_102081221 | 3300024301 | Salt Marsh | MDQKVIISVLFAATVGLIGWNIKTTHELTISVSKLEFILLQDAL |
| Ga0233451_102264841 | 3300024301 | Salt Marsh | TGTAQVMDQKVIISVLFAATVGLIGWNIKTTHELTISVSKLEFILLQDALVK |
| Ga0228670_10032905 | 3300024319 | Seawater | MDQKAIISVLFAAVMGLMGWNIQTTNELQLAVQRLEIILLDDGMSK |
| Ga0209654_10395214 | 3300025608 | Marine | MDQKAIISVLFAAVMGLIGWNIKTTNELQLSVQRLEIILLDDAMAK |
| Ga0209138_10923783 | 3300025617 | Marine | MEKSIMSVLIAAMVALIGWNISTTNELQLAVQRLEILLRADAMEN |
| Ga0209138_11831741 | 3300025617 | Marine | CMDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDGMSK |
| Ga0209136_10087348 | 3300025636 | Marine | MDQKTIISVLFAAVMGLMGWNIKTTNELQLAVQRLEIILLDDGMSK |
| Ga0209136_10524122 | 3300025636 | Marine | MDQKAIISVLFAAVMGLMGWNIKTTNELQLAVQRLEIILLDDGMSK |
| Ga0208643_10572631 | 3300025645 | Aqueous | FPLMDQKAITTVLFASVISLIGWNIKTTNDLQLSVARLEILLRADAMEK |
| Ga0208134_10965682 | 3300025652 | Aqueous | MDQKAITTVLFASVISLIGWNIKTTNDLQLSVARLEILLRADAMEK |
| Ga0208898_10177133 | 3300025671 | Aqueous | MEGKAIIGVLVAALMALATWNLKTTHDLTLAVQRLEIILLNDAMLK |
| Ga0209653_10094143 | 3300025695 | Marine | MDWVKPIISILFAAVVSLIAWNIKTTNDLQLKITRMEVILQNIAMEN |
| Ga0209771_11847153 | 3300025701 | Marine | MDQKAIISVLFAAVMGLMGWNIKTTNELQLAVQRL |
| Ga0208767_12753792 | 3300025769 | Aqueous | MDQKLVTTIVFGALLSLIGWNIKTTNDLQLTVARMEMLLRADALEK |
| Ga0209534_101306461 | 3300025880 | Pelagic Marine | VDQKAIASVLFAAVIGLIGWNIKTTNELQLAVQRL |
| Ga0209632_102280363 | 3300025886 | Pelagic Marine | VDQKAIASVLFAAVIGLIGWNIKTTNELQLAVQRLEIILLSDAIEK |
| Ga0209037_11018562 | 3300027612 | Marine | MDQKAIISVLFAAVMGLIGWNIKTTNELQLAVQRLEIILLNDGMSK |
| Ga0135226_10048553 | 3300029308 | Marine Harbor | PEETLHCFPVTIGLIGWNIKTTNELQLAVQRLEIILLNDAMTK |
| Ga0135210_10023292 | 3300029345 | Marine Harbor | MDTKAIISVLFAAVIGLIGWNIKTTNELQLQVQRLEIILLNDAMTK |
| Ga0348336_199770_418_534 | 3300034375 | Aqueous | VLVAALMALATWNLKTTHDLTLAVQRLEIILLNDAMLK |
| ⦗Top⦘ |