


| Basic Information | |
|---|---|
| Family ID | F088603 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PNMRLKLAGLSFLRESEWLCPGGHGTSSTASCAGGLAARSLSAIR |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 43.12 % |
| % of genes near scaffold ends (potentially truncated) | 58.72 % |
| % of genes from short scaffolds (< 2000 bps) | 74.31 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.385 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.119 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.294 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF07045 | DUF1330 | 2.75 |
| PF12681 | Glyoxalase_2 | 2.75 |
| PF09932 | DUF2164 | 1.83 |
| PF13649 | Methyltransf_25 | 1.83 |
| PF13419 | HAD_2 | 1.83 |
| PF13392 | HNH_3 | 0.92 |
| PF00583 | Acetyltransf_1 | 0.92 |
| PF07681 | DoxX | 0.92 |
| PF01243 | Putative_PNPOx | 0.92 |
| PF07715 | Plug | 0.92 |
| PF04191 | PEMT | 0.92 |
| PF11042 | DUF2750 | 0.92 |
| PF09413 | DUF2007 | 0.92 |
| PF03706 | LPG_synthase_TM | 0.92 |
| PF08592 | Anthrone_oxy | 0.92 |
| PF14534 | DUF4440 | 0.92 |
| PF10012 | DUF2255 | 0.92 |
| PF04893 | Yip1 | 0.92 |
| PF00484 | Pro_CA | 0.92 |
| PF01872 | RibD_C | 0.92 |
| PF03772 | Competence | 0.92 |
| PF16216 | GxGYxYP_N | 0.92 |
| PF07883 | Cupin_2 | 0.92 |
| PF12697 | Abhydrolase_6 | 0.92 |
| PF08734 | GYD | 0.92 |
| PF03144 | GTP_EFTU_D2 | 0.92 |
| PF08378 | NERD | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 2.75 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.92 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.92 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG0658 | DNA uptake channel protein ComEC, N-terminal domain | Intracellular trafficking, secretion, and vesicular transport [U] | 0.92 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.92 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.92 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.92 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.39 % |
| Unclassified | root | N/A | 37.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10110437 | Not Available | 799 | Open in IMG/M |
| 3300002558|JGI25385J37094_10149499 | Not Available | 629 | Open in IMG/M |
| 3300005177|Ga0066690_10945264 | Not Available | 546 | Open in IMG/M |
| 3300005178|Ga0066688_10359635 | Not Available | 943 | Open in IMG/M |
| 3300005180|Ga0066685_10548007 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005180|Ga0066685_10710695 | Not Available | 689 | Open in IMG/M |
| 3300005406|Ga0070703_10306755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas stutzeri group → Pseudomonas stutzeri subgroup → Pseudomonas stutzeri | 663 | Open in IMG/M |
| 3300005444|Ga0070694_101787532 | Not Available | 524 | Open in IMG/M |
| 3300005445|Ga0070708_101032254 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005445|Ga0070708_101175077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300005445|Ga0070708_101763126 | Not Available | 575 | Open in IMG/M |
| 3300005450|Ga0066682_10368683 | Not Available | 923 | Open in IMG/M |
| 3300005451|Ga0066681_10378214 | Not Available | 871 | Open in IMG/M |
| 3300005467|Ga0070706_100125698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2391 | Open in IMG/M |
| 3300005467|Ga0070706_100143215 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2231 | Open in IMG/M |
| 3300005467|Ga0070706_100422995 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300005467|Ga0070706_100792223 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005471|Ga0070698_101245481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 694 | Open in IMG/M |
| 3300005518|Ga0070699_100172217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1918 | Open in IMG/M |
| 3300005518|Ga0070699_101510966 | Not Available | 616 | Open in IMG/M |
| 3300005536|Ga0070697_100186624 | Not Available | 1759 | Open in IMG/M |
| 3300005536|Ga0070697_101643246 | Not Available | 574 | Open in IMG/M |
| 3300005540|Ga0066697_10004210 | All Organisms → cellular organisms → Bacteria | 6804 | Open in IMG/M |
| 3300005545|Ga0070695_100272344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1241 | Open in IMG/M |
| 3300005546|Ga0070696_100105722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2022 | Open in IMG/M |
| 3300005546|Ga0070696_100114573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1944 | Open in IMG/M |
| 3300005553|Ga0066695_10147793 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300005553|Ga0066695_10315131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 985 | Open in IMG/M |
| 3300005555|Ga0066692_10027119 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2988 | Open in IMG/M |
| 3300005555|Ga0066692_10630869 | Not Available | 670 | Open in IMG/M |
| 3300005568|Ga0066703_10287170 | Not Available | 996 | Open in IMG/M |
| 3300005586|Ga0066691_10151044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1336 | Open in IMG/M |
| 3300005586|Ga0066691_10202710 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1156 | Open in IMG/M |
| 3300005586|Ga0066691_10956108 | Not Available | 504 | Open in IMG/M |
| 3300006031|Ga0066651_10597917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
| 3300006034|Ga0066656_10393461 | Not Available | 897 | Open in IMG/M |
| 3300006034|Ga0066656_10480138 | Not Available | 810 | Open in IMG/M |
| 3300006796|Ga0066665_10259962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1378 | Open in IMG/M |
| 3300006797|Ga0066659_10007441 | All Organisms → cellular organisms → Bacteria | 5661 | Open in IMG/M |
| 3300006797|Ga0066659_11027586 | Not Available | 689 | Open in IMG/M |
| 3300006852|Ga0075433_10216209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1703 | Open in IMG/M |
| 3300006854|Ga0075425_100113711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3087 | Open in IMG/M |
| 3300006903|Ga0075426_10881435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 675 | Open in IMG/M |
| 3300009012|Ga0066710_101206816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. XA010 | 1172 | Open in IMG/M |
| 3300009038|Ga0099829_10052679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3021 | Open in IMG/M |
| 3300009088|Ga0099830_10103215 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2131 | Open in IMG/M |
| 3300009137|Ga0066709_100401669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1901 | Open in IMG/M |
| 3300009147|Ga0114129_10109102 | All Organisms → cellular organisms → Bacteria | 3820 | Open in IMG/M |
| 3300009176|Ga0105242_11917027 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010301|Ga0134070_10013873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2566 | Open in IMG/M |
| 3300010323|Ga0134086_10148399 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300010325|Ga0134064_10418817 | Not Available | 539 | Open in IMG/M |
| 3300010329|Ga0134111_10021050 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2199 | Open in IMG/M |
| 3300010329|Ga0134111_10365112 | Not Available | 612 | Open in IMG/M |
| 3300010333|Ga0134080_10112538 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300010336|Ga0134071_10135251 | Not Available | 1192 | Open in IMG/M |
| 3300010396|Ga0134126_12094904 | Not Available | 618 | Open in IMG/M |
| 3300011269|Ga0137392_10143356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1923 | Open in IMG/M |
| 3300012198|Ga0137364_10041007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3029 | Open in IMG/M |
| 3300012198|Ga0137364_10276972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium | 1242 | Open in IMG/M |
| 3300012199|Ga0137383_10202468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1455 | Open in IMG/M |
| 3300012199|Ga0137383_10541483 | Not Available | 852 | Open in IMG/M |
| 3300012199|Ga0137383_10601786 | Not Available | 804 | Open in IMG/M |
| 3300012206|Ga0137380_10155325 | Not Available | 2087 | Open in IMG/M |
| 3300012207|Ga0137381_10582212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300012208|Ga0137376_11051747 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012208|Ga0137376_11104216 | Not Available | 678 | Open in IMG/M |
| 3300012210|Ga0137378_11040516 | Not Available | 733 | Open in IMG/M |
| 3300012211|Ga0137377_10210318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1868 | Open in IMG/M |
| 3300012211|Ga0137377_10342533 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300012211|Ga0137377_10488493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1170 | Open in IMG/M |
| 3300012211|Ga0137377_10707308 | Not Available | 942 | Open in IMG/M |
| 3300012285|Ga0137370_10518481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 731 | Open in IMG/M |
| 3300012349|Ga0137387_10179256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1517 | Open in IMG/M |
| 3300012356|Ga0137371_10964913 | Not Available | 647 | Open in IMG/M |
| 3300012357|Ga0137384_10718728 | Not Available | 811 | Open in IMG/M |
| 3300012357|Ga0137384_10751101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300012359|Ga0137385_11070491 | Not Available | 664 | Open in IMG/M |
| 3300012515|Ga0157338_1070918 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012917|Ga0137395_10040420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2879 | Open in IMG/M |
| 3300012917|Ga0137395_10436874 | Not Available | 939 | Open in IMG/M |
| 3300012972|Ga0134077_10516565 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012976|Ga0134076_10001195 | All Organisms → cellular organisms → Bacteria | 7555 | Open in IMG/M |
| 3300014157|Ga0134078_10205260 | Not Available | 806 | Open in IMG/M |
| 3300015053|Ga0137405_1023935 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300015264|Ga0137403_10432914 | Not Available | 1192 | Open in IMG/M |
| 3300017654|Ga0134069_1008296 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
| 3300017654|Ga0134069_1337724 | Not Available | 540 | Open in IMG/M |
| 3300017659|Ga0134083_10089045 | Not Available | 1206 | Open in IMG/M |
| 3300018468|Ga0066662_12991479 | Not Available | 502 | Open in IMG/M |
| 3300019789|Ga0137408_1238709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1166 | Open in IMG/M |
| 3300020004|Ga0193755_1000532 | All Organisms → cellular organisms → Bacteria | 11075 | Open in IMG/M |
| 3300025885|Ga0207653_10330848 | Not Available | 593 | Open in IMG/M |
| 3300025910|Ga0207684_10063997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3122 | Open in IMG/M |
| 3300025922|Ga0207646_10008669 | All Organisms → cellular organisms → Bacteria | 10156 | Open in IMG/M |
| 3300025922|Ga0207646_10016025 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 7046 | Open in IMG/M |
| 3300025922|Ga0207646_10351572 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300026296|Ga0209235_1035147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 2548 | Open in IMG/M |
| 3300026310|Ga0209239_1031789 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300026310|Ga0209239_1042054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2101 | Open in IMG/M |
| 3300026326|Ga0209801_1008126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5576 | Open in IMG/M |
| 3300026329|Ga0209375_1001123 | All Organisms → cellular organisms → Bacteria | 20722 | Open in IMG/M |
| 3300026329|Ga0209375_1310920 | Not Available | 515 | Open in IMG/M |
| 3300026538|Ga0209056_10026451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5561 | Open in IMG/M |
| 3300026538|Ga0209056_10240779 | Not Available | 1292 | Open in IMG/M |
| 3300027903|Ga0209488_10034957 | All Organisms → cellular organisms → Bacteria | 3670 | Open in IMG/M |
| 3300031753|Ga0307477_10121728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1819 | Open in IMG/M |
| 3300032180|Ga0307471_100323549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1640 | Open in IMG/M |
| 3300032180|Ga0307471_102756454 | Not Available | 624 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 20.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_101104373 | 3300002558 | Grasslands Soil | GVQPNMRLKLAGLSLLKESEWLCPDGHRASSTVRCAGGLAARSLSAIR* |
| JGI25385J37094_101494991 | 3300002558 | Grasslands Soil | MRLKLAGLSLLRESEWLCPDGHELSFNDTARGGLAARSLSAIR* |
| Ga0066690_109452642 | 3300005177 | Soil | VLPNMPLKLAGLSFLRESELLCPNGHELSFNDTACGWLAARSLSAI |
| Ga0066688_103596352 | 3300005178 | Soil | VKQLPNMRLKLPGLSFIRESEWLWPGGHRTSSTARCAGGLAARSLSAIR* |
| Ga0066685_105480072 | 3300005180 | Soil | AEPPNMRLKLAGLPLLKESEWLCPDGHGLSFNGTARGGLAARSLSAIR* |
| Ga0066685_107106951 | 3300005180 | Soil | MPSPSNKQLSNMRLKLAGLSLLSESEWLCPNGHELSFNDPARGGRVARSLSASR* |
| Ga0070703_103067551 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | NMRLKLPGLSLLKETVWLCPSGHELTFNDTARGGPVARSLSAIR* |
| Ga0070694_1017875321 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKLPGLSLLKDSERLCPDGHELTFNDTARGGLVARSLSAIR* |
| Ga0070708_1010322542 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNMRLKLAGLSLLKESERLCPDGHKLSFNGTARGGFAARSLSAIR* |
| Ga0070708_1011750772 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKLPGLSLLKETVWLCPSGHELTFNDTARGGPVARSLSAIR* |
| Ga0070708_1017631261 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VKMHKPPPNMRLKLAGLSLLKESEWLCPGGHELSFNFKCAAGLAARSLSAIR* |
| Ga0066682_103686831 | 3300005450 | Soil | RGVQPNMRLKLAGLSLLKESEWLCPDGHRASSTVRCAGGLAARSLSAIR* |
| Ga0066681_103782141 | 3300005451 | Soil | PNMRLKLAGLSLLKESEWLCPDGHRASSTVRCAGGLAARSLSAIR* |
| Ga0070706_1001256981 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | NMRLKLAGLSLLRESEWLCPSGHELSFNGAPRDGLVARSLSAIR* |
| Ga0070706_1001432154 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VKMLKPPPNMRLKLPGLSLLMESEWLCPGGHELSFNDTPRGGLVARSLSAIR* |
| Ga0070706_1004229953 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RLSNMRLKLAGLSLLKESEWLCPNGHELSFNFKSAGGLAARSLSAIR* |
| Ga0070706_1007922232 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PNMRLKLPGLSLLKESERLCPRGHELTFNDTARGGLVARSLSAIR* |
| Ga0070698_1012454812 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKLAGLSFLMESEWLCPNGHELSFNGTARGELAARSLSAIR* |
| Ga0070699_1001722173 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKLAGLSLLMESEWLCPGGHELSFNDTPRGGLVARSLSAIR* |
| Ga0070699_1015109661 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKLAGLSLLKESEWLCPGGPELSFNDTPRSGLVARSLSAIR* |
| Ga0070697_1001866243 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PNMRLKLAGLSLLKESERLCPDGHKLSFNGTARGGFAARSRSAIR* |
| Ga0070697_1016432462 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RLKLAGLSLLKESEWLCPGGHELSFNVRCAGGLAALSLSAIR* |
| Ga0066697_1000421015 | 3300005540 | Soil | MRLKLAGLSFLRESEWLCSGGHRTSSTRSCAGEPVARSLSAIR* |
| Ga0070695_1002723443 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKLAGLSLFKGIGVLCPGGHELSFNVKCAGGLAARSLSAIR* |
| Ga0070696_1001057222 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVPNMRLKLPGVSVLMEAECFCAGAHELTFNDTPRGGRVARSLSAIR* |
| Ga0070696_1001145734 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKLAGLSFLRESEWLCPSGHELSFNHTPRGGLVARSLSAIR* |
| Ga0066695_101477935 | 3300005553 | Soil | PNMRLKLAGLSLLKESECLCPDGHRTSSPARCAGGLAARSLSAIR* |
| Ga0066695_103151312 | 3300005553 | Soil | MTGPALPNMRLKLAGLSLLMESEWLCPNEHRTASTASCAGGLAARSLSAIR* |
| Ga0066692_100271192 | 3300005555 | Soil | MRLKLPGLSLLKESEWLCPDGHVTSSTARFAGGPAARSLSAIR* |
| Ga0066692_106308692 | 3300005555 | Soil | LSNKRLKLAGLSLLKESERLCPAGHRTSSTASCAGEPAARSLGAIR* |
| Ga0066703_102871701 | 3300005568 | Soil | MRLKLAGLSLLKESECLCPDGHRTSSPARCAGGLAAR |
| Ga0066691_101510443 | 3300005586 | Soil | VHTPLSNKRLKLAGLSFLKESERLCPDGHRTVVHFSCAGGLGARSLSAIR* |
| Ga0066691_102027103 | 3300005586 | Soil | MRLKLAGLSFLKESEWLCPGGHPTSSTTSCAGGLAARSLSAI |
| Ga0066691_109561083 | 3300005586 | Soil | GLSFLKESERLCPDGHRTVVHFSCAGGLRARSLSAIR* |
| Ga0066651_105979171 | 3300006031 | Soil | LAGLSFLKEWEWLCPDGHGTSSTASCAAGHVARSLSAIR* |
| Ga0066656_103934611 | 3300006034 | Soil | PNMRLKLAGLSFLRESEWLCPGGHGTSSTASCAGGLAARSLSAIR* |
| Ga0066656_104801384 | 3300006034 | Soil | NMRLKLAGLSFTRESECLCPGGHGTSSTSSCADEAVARSLTEIR* |
| Ga0066665_102599621 | 3300006796 | Soil | EIGASPNMRLKLAGLSFTRESECLCPGGHGTSSTSSCADEAVARSLTEIR* |
| Ga0066659_100074415 | 3300006797 | Soil | MRLKLAGLSFLRESEWLCSGGHRTSSTRSCAGEPVARSSSAIR* |
| Ga0066659_110275861 | 3300006797 | Soil | MRLKLAGLSLLKESECLCPDGHRTSSPARCAGGLAARS |
| Ga0075433_102162093 | 3300006852 | Populus Rhizosphere | MPPNMRLKLAGLSFLKEPEWLCPNGHELSFHDTARGGLAARSLSAIR* |
| Ga0075425_1001137114 | 3300006854 | Populus Rhizosphere | MRLKLAGLSFLKEPEWLCPNGHELSFHDTARGGLAARSLSAIR* |
| Ga0075426_108814352 | 3300006903 | Populus Rhizosphere | MPPNMRLKLAGLSLLKESEWLCPGGHELPFNDTAHGELVARSLSAIR* |
| Ga0066710_1012068162 | 3300009012 | Grasslands Soil | PPNMRLKLAGLSFLGESEWLCPDGHELSFNDCAPCGHVARSLSAIR |
| Ga0099829_100526793 | 3300009038 | Vadose Zone Soil | VGRLPNMRLKLAGLSFLKESEWLCPNGHRTSSAASCAGALARSLSAIR* |
| Ga0099830_101032153 | 3300009088 | Vadose Zone Soil | MRLKLAGLSLLRESEWLCPCGHRTSSPVSCAGGHVARSLSAIR* |
| Ga0066709_1004016692 | 3300009137 | Grasslands Soil | VVAPPNKRLKLPDPSLLKESEWLCPVGQRTSFTGSCADEPVARSLSAIR* |
| Ga0114129_101091021 | 3300009147 | Populus Rhizosphere | MRLKLAGLSFLKEAEWLCPDGHRTSSTARCAGGLAARSLSAIR* |
| Ga0105242_119170271 | 3300009176 | Miscanthus Rhizosphere | MRLKLAGLSLLKESDRFALAGHERSFNATARSGPVARSLSAIR* |
| Ga0134070_100138732 | 3300010301 | Grasslands Soil | MRLKLAGLSFLRESEWLCSGGHSTSSTRSCAGEPVARSLSAIR* |
| Ga0134086_101483991 | 3300010323 | Grasslands Soil | RLPNMRLKLAGLSLPKEAEWLCPRGHRISSTPRCAGGLAARSLSAIR* |
| Ga0134064_104188171 | 3300010325 | Grasslands Soil | MRLKLAGLSLPKEAEWLCPRGHRISSTPRCAGGLAARSLSA |
| Ga0134111_100210501 | 3300010329 | Grasslands Soil | SRCWGWSRNGMRPNMRLKLAGLSFTRESECLCPGGHGTSSTSSCADEAVARSLTEIR* |
| Ga0134111_103651121 | 3300010329 | Grasslands Soil | VVAPPNKRLKLPDPSLLKESEWLCPVGQRTSFTGSCADEPVARSLSAIR |
| Ga0134080_101125382 | 3300010333 | Grasslands Soil | HEQRPNMRLKLAGLSFLRESERLCPAGHELSLNDTPRGGLIARSLSATR* |
| Ga0134071_101352513 | 3300010336 | Grasslands Soil | NKRLKLAGLSFLRESEWLCPDGQWTSSSTSCAGALAARSLSAIR* |
| Ga0134126_120949042 | 3300010396 | Terrestrial Soil | LSDVAVAPNMRLKLPGLSLLKESEWLTPWRARTDVHLSCAGGFAARSLSAIR* |
| Ga0137392_101433563 | 3300011269 | Vadose Zone Soil | MRLKLAGLSLLEESEWSCPDGHRTSSNASCAGGLAARSLSAIR* |
| Ga0137364_100410076 | 3300012198 | Vadose Zone Soil | MRLKLAGLSFLKESEWLCPNGHELSFNDTARGGLAARSLSAIR* |
| Ga0137364_102769721 | 3300012198 | Vadose Zone Soil | VVAQAQPNMRLKLASLSLLRESEWLCPDGHGLSSAGSCAGGLAARSLSAIR* |
| Ga0137383_102024682 | 3300012199 | Vadose Zone Soil | MRKRLPNKRLKLPGLSFLRESEWLCPGGHRTSSIASCASGLAARSLSANR* |
| Ga0137383_105414831 | 3300012199 | Vadose Zone Soil | RLKLAGLSFLREAELLCPDGHSISSTPRCADGPAARSLSATR* |
| Ga0137383_106017863 | 3300012199 | Vadose Zone Soil | LAGPSLLKESEWLCPDGHGTSSTASCADGLAARSLSAIR* |
| Ga0137380_101553253 | 3300012206 | Vadose Zone Soil | MRLKLPGLSLLKESEWLCPDRHGVSSTASCAGEPAARSLSAIR* |
| Ga0137381_105822121 | 3300012207 | Vadose Zone Soil | RLKLAGLSLLKELEWLCPDGHELSFNDHVPCGHGARSLSAGR* |
| Ga0137376_110517472 | 3300012208 | Vadose Zone Soil | PNMRLKLAGLSLLRESEWLCAGAHEPLFNDTAPGGLLARSLSAIR* |
| Ga0137376_111042162 | 3300012208 | Vadose Zone Soil | MRLKLAGLSLLKESECLCPDGHRTSSPARCAGGLAARSLSAI |
| Ga0137378_110405162 | 3300012210 | Vadose Zone Soil | LTGLSLLKEPESLYPGGHELSFNDTPRGGLVARSLSAIR* |
| Ga0137377_102103181 | 3300012211 | Vadose Zone Soil | NRRLKLAGLSLLGESEWLRPDGHTTSSTTRCAGGRVARSLSAIR* |
| Ga0137377_103425332 | 3300012211 | Vadose Zone Soil | MGGVAPNKRLKLAGLSLLKESEWLCPGGRGRSSTTLVPAGRVARSLSAIR* |
| Ga0137377_104884931 | 3300012211 | Vadose Zone Soil | GLSFLKEWEWLCPDGHGTSSTASYAAGHVARSLRAIR* |
| Ga0137377_107073082 | 3300012211 | Vadose Zone Soil | GLSLLKESEWLCPGGHELSFNDTPRGGLVARTLSAIR* |
| Ga0137370_105184812 | 3300012285 | Vadose Zone Soil | LVVAQAQPNMRLKLASLSLLRESEWLCPDGHGLSSAGSCAGGLAARSLSASR* |
| Ga0137387_101792561 | 3300012349 | Vadose Zone Soil | MRLKLPGLSLLKESEWLCPDGHRTSSTVRCAGGLAARGLSA |
| Ga0137371_109649131 | 3300012356 | Vadose Zone Soil | MRKRLPNKRLKLPGLSFLRESEWLCPGGHRTSSTARCAAGLAARSLSAIR* |
| Ga0137384_107187281 | 3300012357 | Vadose Zone Soil | MRLPNMRLKLPGLSLLKESEWLRPGGHRTSSAASCAGGLAARSLSAIR* |
| Ga0137384_107511012 | 3300012357 | Vadose Zone Soil | RLKLAGLSFTRESECLCPGGHGTSSTSSCADGAVARSLGAIR* |
| Ga0137385_110704911 | 3300012359 | Vadose Zone Soil | MRLKLGGLSLLKESEWLCPGGHRTSSTVRCAGGLAAR |
| Ga0157338_10709181 | 3300012515 | Arabidopsis Rhizosphere | MPLPNIRLKLAGLSLLKESDRCALAGHERSFNATARSGPVA |
| Ga0137395_100404202 | 3300012917 | Vadose Zone Soil | MPRPNMRLKLAGLSLLRESEGLCPDGHTPSSTARCAGGLAARSLSAIR* |
| Ga0137395_104368741 | 3300012917 | Vadose Zone Soil | LSNMRLKLAGLSLLKESEWLCPGGHELSFNDTPRGGLVARSLSAIR* |
| Ga0134077_105165652 | 3300012972 | Grasslands Soil | GLPLLKESEWLCPDGHGLSFNGTARGGLAARSLSAIR* |
| Ga0134076_100011959 | 3300012976 | Grasslands Soil | MRLKLAGLSFLRESEWLCSGGHRTSSTRSCAGEPVTRSLSAIR* |
| Ga0134078_102052601 | 3300014157 | Grasslands Soil | GINAELPNKRLKLPGASVLMESEWLCPGGHGPTSTASCAGGLVARSLTAIR* |
| Ga0137405_10239351 | 3300015053 | Vadose Zone Soil | RLNLAGLSLLKESEWLCPSQARTDVHLSCAGGLAARSLGAIR* |
| Ga0137403_104329144 | 3300015264 | Vadose Zone Soil | DDSITVTGLPNMRLKLAGLSFLRESEWLCPDGHRTSSTASCAGGRVARSLSAIR* |
| Ga0134069_10082962 | 3300017654 | Grasslands Soil | VCLEVAALSNMRLKLAGLSFLRESEWLCSGGHRTSSTRSCAGEPVARSLSAIR |
| Ga0134069_13377241 | 3300017654 | Grasslands Soil | VVAPPNKRLKLPGLSLLKESEWLCPGGHRPSSTACYAGGPVARSLS |
| Ga0134083_100890451 | 3300017659 | Grasslands Soil | KRLKLARLSFLRESEWLCPDGHRTSSTARCAGGLAARSLSATR |
| Ga0066662_129914791 | 3300018468 | Grasslands Soil | GPPNMRLKLAGLSFLKESEWLCPGGHPTSSTTSCAGGLAARSLSAIG |
| Ga0137408_12387092 | 3300019789 | Vadose Zone Soil | MPRPNMRLKLAGLSLLRESEGLCPDGHTPSSTARCAGGLAARSLSA |
| Ga0193755_10005322 | 3300020004 | Soil | MRLKLAGLSFLRESEWLYPDGHRTSPIASCAGVHVARSLSAIR |
| Ga0207653_103308481 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | TSVIGILEHRPNMRLKLAGLSLLKESEWLCPNGHELSFNFKSAGGLAARSLSAIR |
| Ga0207684_100639977 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ALSSKRLKLAGLSLLRESEWLCPSGHELSFNGAPRDGLVARSLSAIR |
| Ga0207646_1000866916 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKLAGLSLLKESEWLCPNVHELSFHGTALGGRVARSLSAIR |
| Ga0207646_1001602510 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPNKRLKLAGLSLLKESERLCPGGHVLSFNDTAPCGPAARSLSAIR |
| Ga0207646_103515724 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LKLPGLSLLKETVWLCPSGHELTFNDTARGGPVARSLSAIR |
| Ga0209235_10351472 | 3300026296 | Grasslands Soil | MMAPPNKRLKLAGLSLSKESEGLCTWRALTLVQYACAGGLAARSLSAIR |
| Ga0209239_10317893 | 3300026310 | Grasslands Soil | MRLKLAGLSLLKESECLCPDGHRTSSPARCAGGLAARSLSAIR |
| Ga0209239_10420544 | 3300026310 | Grasslands Soil | LKLAGLSFTRESECLCPGGHGTSSTSSCADEAVARSLTEIR |
| Ga0209801_10081266 | 3300026326 | Soil | MRLKLAGLSFLRESEWLCSGGHRTSSTRSCAGEPVARSLSAIR |
| Ga0209375_10011231 | 3300026329 | Soil | RPNMRLKLAGLSFLRESEWLCSGGHRTSSTRSCAGEPVARSLSAIR |
| Ga0209375_13109202 | 3300026329 | Soil | MRLKLAGLSLPKEAEWLCPRGHRISSTPRCAGGLAARS |
| Ga0209056_100264518 | 3300026538 | Soil | GASCCLTRVHEIGASPNMRLKLAGLSFTRESECLCPGGHGTSSTSSCADEAVARSLTEIR |
| Ga0209056_102407791 | 3300026538 | Soil | RRLLPPNMRLKLAGLSLLGESEWLCSDGHTTSSTTRCAGGRAARRLSAIR |
| Ga0209488_100349574 | 3300027903 | Vadose Zone Soil | MPRPNMRLKLAGLSLLRESEGLCPDGHTPSSTARCAGGLAARSLSAIR |
| Ga0307477_101217282 | 3300031753 | Hardwood Forest Soil | MRLKLPGISLYMETERWRPGGRELSFNDSPRGGRVARNLSAIR |
| Ga0307471_1003235493 | 3300032180 | Hardwood Forest Soil | MRLKLAGLSLLKESEWLCPDGHRTASTASCAGGRVGRSLSAIR |
| Ga0307471_1027564543 | 3300032180 | Hardwood Forest Soil | SMRLKLSGLSLLKESEWLCPGGHELSFNDTARGELVARSLSAIR |
| ⦗Top⦘ |