


| Basic Information | |
|---|---|
| Family ID | F088339 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLFEAFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIWDPWGIWKEK |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 79.82 % |
| % of genes near scaffold ends (potentially truncated) | 18.35 % |
| % of genes from short scaffolds (< 2000 bps) | 58.72 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (80.734 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (18.349 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.963 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.560 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 9.17 |
| PF00768 | Peptidase_S11 | 7.34 |
| PF09825 | BPL_N | 2.75 |
| PF00211 | Guanylate_cyc | 2.75 |
| PF05226 | CHASE2 | 1.83 |
| PF00848 | Ring_hydroxyl_A | 1.83 |
| PF00355 | Rieske | 1.83 |
| PF00487 | FA_desaturase | 1.83 |
| PF03401 | TctC | 0.92 |
| PF01541 | GIY-YIG | 0.92 |
| PF02627 | CMD | 0.92 |
| PF00478 | IMPDH | 0.92 |
| PF01145 | Band_7 | 0.92 |
| PF03797 | Autotransporter | 0.92 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.92 |
| PF00535 | Glycos_transf_2 | 0.92 |
| PF01165 | Ribosomal_S21 | 0.92 |
| PF04773 | FecR | 0.92 |
| PF14235 | DUF4337 | 0.92 |
| PF06347 | SH3_4 | 0.92 |
| PF11750 | DUF3307 | 0.92 |
| PF00004 | AAA | 0.92 |
| PF01171 | ATP_bind_3 | 0.92 |
| PF00147 | Fibrinogen_C | 0.92 |
| PF00574 | CLP_protease | 0.92 |
| PF00166 | Cpn10 | 0.92 |
| PF02274 | ADI | 0.92 |
| PF01176 | eIF-1a | 0.92 |
| PF12850 | Metallophos_2 | 0.92 |
| PF12708 | Pectate_lyase_3 | 0.92 |
| PF05118 | Asp_Arg_Hydrox | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 7.34 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 3.67 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.75 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.83 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.83 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.83 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.83 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 1.83 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.92 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.92 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.92 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.92 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.92 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.92 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.92 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.24 % |
| Unclassified | root | N/A | 13.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109671850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| 3300002447|JGI24768J34885_10126477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300002835|B570J40625_100002866 | Not Available | 32278 | Open in IMG/M |
| 3300002835|B570J40625_100007166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20570 | Open in IMG/M |
| 3300003277|JGI25908J49247_10001233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8111 | Open in IMG/M |
| 3300003277|JGI25908J49247_10031143 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300003754|Ga0005853_1041578 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300005517|Ga0070374_10022979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3185 | Open in IMG/M |
| 3300005527|Ga0068876_10000681 | Not Available | 27622 | Open in IMG/M |
| 3300005527|Ga0068876_10014079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5170 | Open in IMG/M |
| 3300005527|Ga0068876_10015741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4850 | Open in IMG/M |
| 3300005527|Ga0068876_10084154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1906 | Open in IMG/M |
| 3300005527|Ga0068876_10249664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
| 3300005527|Ga0068876_10572251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300005528|Ga0068872_10005366 | All Organisms → cellular organisms → Bacteria | 9596 | Open in IMG/M |
| 3300005528|Ga0068872_10218867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
| 3300005581|Ga0049081_10147835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300005582|Ga0049080_10270668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300005662|Ga0078894_10030701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4426 | Open in IMG/M |
| 3300005662|Ga0078894_10057767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3310 | Open in IMG/M |
| 3300005662|Ga0078894_10087405 | Not Available | 2727 | Open in IMG/M |
| 3300005662|Ga0078894_10788601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300005662|Ga0078894_11539980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300005662|Ga0078894_11584718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300005662|Ga0078894_11681596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300005805|Ga0079957_1110884 | Not Available | 1472 | Open in IMG/M |
| 3300007214|Ga0103959_1165312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8796 | Open in IMG/M |
| 3300007216|Ga0103961_1121845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3294 | Open in IMG/M |
| 3300008107|Ga0114340_1063244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1581 | Open in IMG/M |
| 3300008107|Ga0114340_1213357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300008108|Ga0114341_10003793 | Not Available | 23401 | Open in IMG/M |
| 3300008110|Ga0114343_1194740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300008113|Ga0114346_1002388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22107 | Open in IMG/M |
| 3300008113|Ga0114346_1221458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300008266|Ga0114363_1116059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300008962|Ga0104242_1003309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3070 | Open in IMG/M |
| 3300010354|Ga0129333_10000034 | Not Available | 72449 | Open in IMG/M |
| 3300010354|Ga0129333_10003959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13893 | Open in IMG/M |
| 3300010354|Ga0129333_10011524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8377 | Open in IMG/M |
| 3300010354|Ga0129333_10194726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1845 | Open in IMG/M |
| 3300010354|Ga0129333_10487944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300010354|Ga0129333_10830356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300010354|Ga0129333_10960815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300010354|Ga0129333_11203203 | Not Available | 629 | Open in IMG/M |
| 3300011268|Ga0151620_1091199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
| 3300012665|Ga0157210_1000078 | Not Available | 53267 | Open in IMG/M |
| 3300013004|Ga0164293_10170988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1595 | Open in IMG/M |
| 3300013005|Ga0164292_10060117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2958 | Open in IMG/M |
| 3300013005|Ga0164292_10391267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10002268 | Not Available | 26580 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10032918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4476 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10000953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 47113 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10046573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3814 | Open in IMG/M |
| 3300017788|Ga0169931_10008049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15480 | Open in IMG/M |
| 3300020074|Ga0194113_10038784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4809 | Open in IMG/M |
| 3300020141|Ga0211732_1185230 | Not Available | 2670 | Open in IMG/M |
| 3300020151|Ga0211736_10448380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3492 | Open in IMG/M |
| 3300020151|Ga0211736_10893541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300020159|Ga0211734_10805666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1337 | Open in IMG/M |
| 3300020160|Ga0211733_11233968 | Not Available | 2293 | Open in IMG/M |
| 3300020161|Ga0211726_10249846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300020161|Ga0211726_10495224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300020162|Ga0211735_10151277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300020162|Ga0211735_10712488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2690 | Open in IMG/M |
| 3300020162|Ga0211735_11054243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300020172|Ga0211729_10581841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
| 3300020172|Ga0211729_11343909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300020172|Ga0211729_11394908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
| 3300020179|Ga0194134_10003292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17631 | Open in IMG/M |
| 3300020198|Ga0194120_10292420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300020205|Ga0211731_10149586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300020506|Ga0208091_1040648 | Not Available | 505 | Open in IMG/M |
| 3300020527|Ga0208232_1001010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5261 | Open in IMG/M |
| 3300020527|Ga0208232_1003073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2892 | Open in IMG/M |
| 3300021962|Ga0222713_10059079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2890 | Open in IMG/M |
| 3300021963|Ga0222712_10085671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2239 | Open in IMG/M |
| 3300024289|Ga0255147_1005842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2801 | Open in IMG/M |
| 3300024289|Ga0255147_1024086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
| 3300024298|Ga0255178_1105195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300024484|Ga0256332_1076709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300024505|Ga0255150_1010080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1653 | Open in IMG/M |
| 3300026457|Ga0255160_1067295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300026571|Ga0255289_1095995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300026573|Ga0255269_1203292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300027149|Ga0255108_1095724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300027608|Ga0208974_1000890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11905 | Open in IMG/M |
| 3300027769|Ga0209770_10278712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300027805|Ga0209229_10527333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027816|Ga0209990_10380690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300027836|Ga0209230_10001671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8954 | Open in IMG/M |
| 3300028025|Ga0247723_1002083 | All Organisms → Viruses | 11002 | Open in IMG/M |
| 3300028103|Ga0255172_1070587 | Not Available | 631 | Open in IMG/M |
| 3300031758|Ga0315907_10155707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
| 3300031758|Ga0315907_10505292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300031758|Ga0315907_10886793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300031787|Ga0315900_10162475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2044 | Open in IMG/M |
| 3300031857|Ga0315909_10003382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19494 | Open in IMG/M |
| 3300031857|Ga0315909_10180162 | Not Available | 1699 | Open in IMG/M |
| 3300031951|Ga0315904_10103699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2983 | Open in IMG/M |
| 3300031951|Ga0315904_10336586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
| 3300031951|Ga0315904_10624316 | Not Available | 922 | Open in IMG/M |
| 3300032092|Ga0315905_10921129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300032116|Ga0315903_10726636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300033978|Ga0334977_0000466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25251 | Open in IMG/M |
| 3300033992|Ga0334992_0113002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1437 | Open in IMG/M |
| 3300034102|Ga0335029_0027152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4328 | Open in IMG/M |
| 3300034106|Ga0335036_0587724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300034284|Ga0335013_0415073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300034356|Ga0335048_0195870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.09% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.17% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.34% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.59% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.75% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.75% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.83% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.92% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.92% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027149 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1096718504 | 3300002408 | Freshwater | MLFEAFMVFYLLECLVLITVAFWFYYEPKKLKKKIYNPWGFWD* |
| JGI24768J34885_101264773 | 3300002447 | Freshwater And Sediment | MLFEAFLVFWMLEVLVLASVAVWYYYXPIEKEKKIWDPWGIWREIK* |
| B570J40625_10000286622 | 3300002835 | Freshwater | MLFEAFLVFYLLEILVLAIAVFYYVYEPKKQQRKIYDPWGFWKELR* |
| B570J40625_10000716659 | 3300002835 | Freshwater | MLFESFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIWDPWGIWKEK* |
| JGI25908J49247_100012339 | 3300003277 | Freshwater Lake | MLFEAFLVFWMLEILVLASVAVWYYYEPKQQEKKIWDPWGIWKEN* |
| JGI25908J49247_100311433 | 3300003277 | Freshwater Lake | MLFEAFLVFWMLEVLVLASVAVWYYYEPIEKEKKIWDPWGIWREIK* |
| Ga0005853_10415782 | 3300003754 | Freshwater And Sediment | MLFEAFLVFWMLEVLVLASVAVWYYYKPIEKEKKIWDPWGIWREIK* |
| Ga0070374_100229796 | 3300005517 | Freshwater Lake | MLFEAFLVFWMLEILVLVSVAVWYYHEPKVQEKKIHDPWGFWKE* |
| Ga0068876_1000068141 | 3300005527 | Freshwater Lake | MFEAFMIFYLLEVLVLVSVAVWYYKEPKKVEKKLHDPWGFFRGTK* |
| Ga0068876_1001407910 | 3300005527 | Freshwater Lake | MLFEAFLVFWMLEVLVLASVAVWYYYEPIEKEKKIWDPWGIWKEVK* |
| Ga0068876_100157415 | 3300005527 | Freshwater Lake | MLFEAFLVFYLLEILVLAIAVFYYVYEPKKQQRKVYDPWGFWKELR* |
| Ga0068876_100841544 | 3300005527 | Freshwater Lake | MLFEAFLVFWMLEILVLASVAVWYYYEPAEKEKKIWDPWGIWKEVK* |
| Ga0068876_102496641 | 3300005527 | Freshwater Lake | MLFEAFMVFYLLECLMLISVAVWYYHEPKKQEKRIWDPWGIWKQEK* |
| Ga0068876_105722513 | 3300005527 | Freshwater Lake | MIFYLLETLVLISVAVWYYHEPKTEQKKIHDPWGFWKEEK* |
| Ga0068872_100053662 | 3300005528 | Freshwater Lake | MIFYLLEVLVLVSVAVWYYKEPKKVEKKLHDPWGFFRGTK* |
| Ga0068872_102188672 | 3300005528 | Freshwater Lake | MLFEAFLVFYMLEVLVLVSVAIWYFYEPKVQEKKIWDPWGIWKEK* |
| Ga0049081_101478352 | 3300005581 | Freshwater Lentic | MLFEAFLVFWMLEVLVLVSVAVWYYYEPKVQKKKIHDPWGFWKE* |
| Ga0049080_102706683 | 3300005582 | Freshwater Lentic | MLFEAFLVFWMLEVLVLASVAVWYYYEPAEKEKKIWDPWGIWKEVK* |
| Ga0078894_100307014 | 3300005662 | Freshwater Lake | MGLIFESFLIFYMLEVLVLASVAVWYYYEPKQPEKKIWDPWGIWKE* |
| Ga0078894_100577678 | 3300005662 | Freshwater Lake | MLFESFLVFYMLEVLVLVSVAVWYYYEPKKQEKKIWDPWGIWKEK* |
| Ga0078894_100874051 | 3300005662 | Freshwater Lake | MLFEAFLVFWMLEVLVLVSVAVWYYHKPKVQEKKIHDPWGFWKE* |
| Ga0078894_107886012 | 3300005662 | Freshwater Lake | MLFEAFLVFWMLEVLVLASVAVWYYYEPAEKEKTIWDPWGIWKEVK* |
| Ga0078894_115399802 | 3300005662 | Freshwater Lake | MLFEAFLVFWMLEVLVLVSVAVWYYREPKVQEKKIHDPWGFWKE* |
| Ga0078894_115847182 | 3300005662 | Freshwater Lake | MLFEAFLVFYMLEVLVLVSVGVWYFYEPRQEEKKIWDPWGIWKEMK* |
| Ga0078894_116815962 | 3300005662 | Freshwater Lake | MLFEAFLVFWMLEILVLVSVAVWHYHEPKVQEKKIHDPWGFWKE* |
| Ga0079957_11108842 | 3300005805 | Lake | MSTLFESFMVFYFIEVFVLISVFIWYYKEPKKQEKKIHDPWGIWKEIRK* |
| Ga0103959_116531221 | 3300007214 | Freshwater Lake | MLFEAFLVFWLLEFLVILCVIAYYYYEPKPQTKKIYDPWGFWKNVK* |
| Ga0103961_11218455 | 3300007216 | Freshwater Lake | MLFEAFLVFYLLECLVLLSVAVWYYHEPKPKIKKIHDPWGFWSKEK* |
| Ga0114340_10632444 | 3300008107 | Freshwater, Plankton | MLFEAFLIFWLLELLVLISVGMYYFYEPKEKQKKIYDPWGFWKGEKK* |
| Ga0114340_12133571 | 3300008107 | Freshwater, Plankton | LIFWLLELLVLISVGMYYFYEPKEKQKKIYDPWGFWKGEKK* |
| Ga0114341_1000379367 | 3300008108 | Freshwater, Plankton | MVFYLLECLVLVSAFIYYHHEPKQKQKKIWDPWGFWQGEK* |
| Ga0114343_11947404 | 3300008110 | Freshwater, Plankton | MLFESFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIWDPW |
| Ga0114346_100238817 | 3300008113 | Freshwater, Plankton | MLFEAFLVFWMLVVFWMLEILVLASVAVWYYYEPKQQEKKIWDPWGIWKEN* |
| Ga0114346_12214581 | 3300008113 | Freshwater, Plankton | MLFEAFLVFWMLEILVLASVAVWYYYEPKQQEKKIWDPWGIWKE |
| Ga0114363_11160592 | 3300008266 | Freshwater, Plankton | MLFEAFMVFYLLECLMLTSVAVWYYHEPKKQEKKIWDPWGIWKQEK* |
| Ga0104242_10033097 | 3300008962 | Freshwater | MLFEAFMVFYLLECLVLTSVAVWYFHEPKKQEKKIWDPWGIWKEK* |
| Ga0129333_100000348 | 3300010354 | Freshwater To Marine Saline Gradient | MLFESFLVFYLLEILVLVSVAIWYYYEPKKPEKKIWDPWGMWKN* |
| Ga0129333_1000395920 | 3300010354 | Freshwater To Marine Saline Gradient | MLFEAFMVFYLIECLVLISVAVWYFYEPKKIAKKIYDPWGFWGKEK* |
| Ga0129333_100115245 | 3300010354 | Freshwater To Marine Saline Gradient | MSTLFEAYMVFYTIECAVLISVAAWYLHEPKEAPKKVWDPWGIWKGVE* |
| Ga0129333_101947263 | 3300010354 | Freshwater To Marine Saline Gradient | VDVSDLFEAYMVFYTIECLVLISVAVWYCREPKVKTKKIWDPWGIWKDLK* |
| Ga0129333_104879442 | 3300010354 | Freshwater To Marine Saline Gradient | MFEAFMVFYLLEVLVLTSVAVWYYKEPKKVEKKIHDPWGFWKGVK* |
| Ga0129333_108303563 | 3300010354 | Freshwater To Marine Saline Gradient | MLLEAFFVFYLLEILVLTIWFLLYYREPKQKEKKVYNPWGFWDKES* |
| Ga0129333_109608152 | 3300010354 | Freshwater To Marine Saline Gradient | VDVSRLFEAFMVFYALECLVLVSVAVWYYHEPKEKPKKIWDPWGVWKGME* |
| Ga0129333_112032031 | 3300010354 | Freshwater To Marine Saline Gradient | MLFESFMIFYLLEILVLVSVAIWYYKEPKTIEKKIHDPWGFFKGENK* |
| Ga0151620_10911994 | 3300011268 | Freshwater | MLFEAFMVFYLLECLVLVAVAFWYYYEPKKQEKKIWDPWGVWKGVK* |
| Ga0157210_10000785 | 3300012665 | Freshwater | MLFEAFMVFYLLECLVLVAVAFWYYYEPKKQEQKIWDPWGVWKGVK* |
| Ga0164293_101709884 | 3300013004 | Freshwater | MLFEAFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIWDPWGIWKEK* |
| Ga0164292_100601171 | 3300013005 | Freshwater | MLFEAFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIWDPWGIW |
| Ga0164292_103912671 | 3300013005 | Freshwater | LEVLVLVSVAVWYYYEPKVQEKKIWDPWGIWKEK* |
| (restricted) Ga0172367_1000226825 | 3300013126 | Freshwater | MLFESFMIFYLLEILVLISMAIWYYKEPKLIEKKIHDPWGFLERRKIK* |
| (restricted) Ga0172367_100329185 | 3300013126 | Freshwater | MLFEAFLVFYLLEILVIACAVIYHYHEPKQQQRKIYDPWGFWKE* |
| (restricted) Ga0172373_1000095332 | 3300013131 | Freshwater | MLFEAFLIFYLIECLVLVSVAVWYYREPKQIEKKVWDPWGIWREK* |
| (restricted) Ga0172373_100465732 | 3300013131 | Freshwater | MFEAFMVFYLLEILVLTSVAVWYYREPKQVEKKIHDPWGFWKGEK* |
| Ga0169931_100080498 | 3300017788 | Freshwater | MLLEAFLVFYLLEILVLVSVAAWYLYEPKKPEKKIYNPWGFWKE |
| Ga0194113_100387842 | 3300020074 | Freshwater Lake | MFEAFMVFYLLEILVLTSVAVWYYREPKQVEKKIHDPWGFWKGEK |
| Ga0211732_11852306 | 3300020141 | Freshwater | MLFEAFLVFWMLEILVLASVAVWYYHEPAKKEKKIWDPWGIWKEIK |
| Ga0211736_104483805 | 3300020151 | Freshwater | MLFEAFLVFWMLEVLVLASVAVWYYYEPIEKEKKIWDPWGIWKEVK |
| Ga0211736_108935412 | 3300020151 | Freshwater | MLFESFLVFWMLEVLVLISVAVWYYHEPKVQEKKIHDPWGFWKEK |
| Ga0211734_108056664 | 3300020159 | Freshwater | MLFEAFMVFYLLECLVLTSVAVWYYHEPKKQEKRIWDPWGIWKQEK |
| Ga0211733_112339684 | 3300020160 | Freshwater | MLFEAFLVFWMLEVLVLASVAVWYYYEPVEKEKKIWDPWGIWKEIK |
| Ga0211726_102498463 | 3300020161 | Freshwater | MLFEAFMVFYLLECLVLTSVAVWYYHEPKKQEKKIWDPWGVWKQEK |
| Ga0211726_104952241 | 3300020161 | Freshwater | MLFESFLVFWMLEVLVLISVAVWYYHEPKVQEKKIHDPWGFWKE |
| Ga0211735_101512775 | 3300020162 | Freshwater | MGLIFESFLIFYMLEVLVLVSVAVWYCYEPKQPEKKIWDPWGIWKE |
| Ga0211735_107124881 | 3300020162 | Freshwater | LALLFESFLVFYMLEILVLVSVAVWYYYEPKQQEKKIW |
| Ga0211735_110542431 | 3300020162 | Freshwater | VFYMLEILVLVSVAVWYYYEPKQQEKKIWDPWGIWKEK |
| Ga0211729_105818411 | 3300020172 | Freshwater | LECLVLTSVAVWYYHEPKKQEKKIWDPWGIWKQEK |
| Ga0211729_113439093 | 3300020172 | Freshwater | MLFEAFMVFYLLECLVLTSVAVWYYHEPKKQEKKIWDPWGIWKQEK |
| Ga0211729_113949082 | 3300020172 | Freshwater | MLFESFLVFSMLEVLVIISVAVWYYHEPKVQEKKIHDPWGFWKEK |
| Ga0194134_100032924 | 3300020179 | Freshwater Lake | MVFYLLEILVLTSVAVWYYREPKQVEKKIHDPWGFWKGEK |
| Ga0194120_102924201 | 3300020198 | Freshwater Lake | DSDMFEAFMVFYLLEILVLTSVAVWYYREPKQVEKKIHDPWGFWKGEK |
| Ga0211731_101495862 | 3300020205 | Freshwater | MLFEAFLVFWMLEVLVLVSVAVWFYHEPAKKEKKIWDPWGIWKEIK |
| Ga0208091_10406481 | 3300020506 | Freshwater | MLFESFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIWDPWGIW |
| Ga0208232_10010107 | 3300020527 | Freshwater | FYMLEVLVLVSVAVWYYYEPKVQEKKIWDPWGIWKEK |
| Ga0208232_10030732 | 3300020527 | Freshwater | MLFEAFLVFWMLEVLVLASVAVWYYYEPAEKEKKIWDPWGIWKEVK |
| Ga0222713_100590793 | 3300021962 | Estuarine Water | MLFEAFMVFYLLECLVLISVAVWYFYEPKKQTKKIYNPWGFWGEEK |
| Ga0222712_100856716 | 3300021963 | Estuarine Water | MLFEAFMVFYLLECLVLVAVAFWYYYEPKKQEKKIWDPWGVWKGVK |
| Ga0255147_10058425 | 3300024289 | Freshwater | MLFEAFMVFYLLECLVLISVAVWYFYEPKKQTKKIYNPWGFWGKEK |
| Ga0255147_10240863 | 3300024289 | Freshwater | MLFEAFIVFYLLECLVLVSVAIWYFYEPKKQEKRMYNPWGFWDEEK |
| Ga0255178_11051952 | 3300024298 | Freshwater | MLFEAFMVFYLLECLVLISVAVWYYREPKKQEKKIWDPWGIWKGVK |
| Ga0256332_10767093 | 3300024484 | Freshwater | LFEAFMVFYLLECLVLISVAVWYFYEPKKQTKKIYNPWGFWGKEK |
| Ga0255150_10100801 | 3300024505 | Freshwater | MLFEAFIVFYLLECLVLVSVAIWYFYEPKKQEKRMYNPWGFWD |
| Ga0255160_10672953 | 3300026457 | Freshwater | AFIVFYLLECLVLVSVAIWYFYEPKKQEKRMYNPWGFWDEEK |
| Ga0255289_10959951 | 3300026571 | Freshwater | TFNRLMLFEAFMVFYLLECLVLISVAVWYFYEPKKQTKKIYNPWGFWGKEK |
| Ga0255269_12032922 | 3300026573 | Freshwater | MLFEAFLVFWMLEVLVLILVAVYYFYEPKQPEKKLHDPWGFRKEVK |
| Ga0255108_10957242 | 3300027149 | Freshwater | MLFEAFLVFWMLEILVLVSVAVWYYYEPKVQEKKIHDPWGFWKE |
| Ga0208974_100089018 | 3300027608 | Freshwater Lentic | MLFEAFLVFWMLEVLVLVSVAVWYYYEPKVQKKKIHDPWGFWKE |
| Ga0209770_102787121 | 3300027769 | Freshwater Lake | MLFEAFLVFWMLEVLVLVSVAVWYYYEPAEKEKKIWDPWGIWKE |
| Ga0209229_105273331 | 3300027805 | Freshwater And Sediment | MLFEAFLVFYMLEVLVLVLVAIWYFYEPKVQEKKIWDPWGIWKEK |
| Ga0209990_103806903 | 3300027816 | Freshwater Lake | MIFYLLETLVLISVAVWYYHEPKTEQKKIHDPWGFWKEEK |
| Ga0209230_1000167112 | 3300027836 | Freshwater And Sediment | MLFEAFLVFWMLEVLVLASVAVWYYYKPIEKEKKIWDPWGIWREIK |
| Ga0247723_100208311 | 3300028025 | Deep Subsurface Sediment | RAMLFEAFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIHDPWGFWKE |
| Ga0255172_10705872 | 3300028103 | Freshwater | MLFEAFLVFWMLEVLVLILVAVYYFYEPKQPEKKLHDPWGFWKEVK |
| Ga0315907_101557075 | 3300031758 | Freshwater | MLFEAFLVFYMLEVLVLVSVAIWYFYEPKVQEKKIWDPWGIWKEK |
| Ga0315907_105052922 | 3300031758 | Freshwater | MLFEAFMVFYLLECLILIAIAVWYFHEPKQENKKIWDPWGFWQGGK |
| Ga0315907_108867932 | 3300031758 | Freshwater | MLFEAFMVFYLLECLMLTSVAVWYYHEPKKQEKKIWDPWGIWKQEK |
| Ga0315900_101624751 | 3300031787 | Freshwater | MLFEAFLVFWMLEILVLVSVAVWYYREPKVQEKKIHDPWGFWKE |
| Ga0315909_1000338217 | 3300031857 | Freshwater | LGLLFEAFMIFYLLETLVLISVAVWYYHEPKTEQKKIHDPWGFWKEEK |
| Ga0315909_101801625 | 3300031857 | Freshwater | MVFYLLECLVLVSAFIYYHHEPKQKQKKIWDPWGFWQGEK |
| Ga0315904_101036994 | 3300031951 | Freshwater | MLFEAFLVFWMLEVLVLVSVAIWYFYEPKVQEKKIWDPWGIWKEK |
| Ga0315904_103365861 | 3300031951 | Freshwater | MIFYLLEVLVLVSVAVWYYKEPKKVEKKLHDPWGFFRGTK |
| Ga0315904_106243161 | 3300031951 | Freshwater | MSLLFESFMVFYLIELVVLSLVIFWYYKEPKKQEHKLWDPWGFWK |
| Ga0315905_109211292 | 3300032092 | Freshwater | MFEAFMIFYLLEVLVLVSVAVWYYKEPKKVEKKLHDPWGFFKGVK |
| Ga0315903_107266363 | 3300032116 | Freshwater | MLFEAFMVFYLLECLILVAVAVWYFHEPKQENKKIWDPWGFWQGGK |
| Ga0334977_0000466_16882_17016 | 3300033978 | Freshwater | MLFEAFLVFWMLEVLVLVSVAVWYYHKPKVQEKKIHDPWGFWKE |
| Ga0334992_0113002_1149_1286 | 3300033992 | Freshwater | MLFEAFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIWDPWGIWKEK |
| Ga0335029_0027152_1763_1894 | 3300034102 | Freshwater | MLFEAFMVFYLLECLVLITVAFWFYYEPKKLKKKIYNPWGFWD |
| Ga0335036_0587724_1_120 | 3300034106 | Freshwater | MLFEAFLVFYLLEILVLAIAVFYYVYEPKKQQRKIYDPWG |
| Ga0335013_0415073_670_825 | 3300034284 | Freshwater | MLFEAFLVFYMLEVLVLVSVAVWYYYEPKVQEKKIWDPWVSGRRNKWLTYPN |
| Ga0335048_0195870_1001_1117 | 3300034356 | Freshwater | MLFEAFLVFWMLEVLVLVSVAVWYYHKPKVQEKKIHDPW |
| ⦗Top⦘ |