


| Basic Information | |
|---|---|
| Family ID | F088270 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILF |
| Number of Associated Samples | 34 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.71 % |
| % of genes near scaffold ends (potentially truncated) | 16.51 % |
| % of genes from short scaffolds (< 2000 bps) | 71.56 % |
| Associated GOLD sequencing projects | 30 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.807 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (29.358 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.202 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (33.028 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.33% β-sheet: 0.00% Coil/Unstructured: 91.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF14437 | MafB19-deam | 1.83 |
| PF05016 | ParE_toxin | 1.83 |
| PF00155 | Aminotran_1_2 | 1.83 |
| PF01609 | DDE_Tnp_1 | 1.83 |
| PF00005 | ABC_tran | 1.83 |
| PF01850 | PIN | 1.83 |
| PF05036 | SPOR | 1.83 |
| PF01182 | Glucosamine_iso | 1.83 |
| PF04011 | LemA | 0.92 |
| PF01925 | TauE | 0.92 |
| PF10543 | ORF6N | 0.92 |
| PF04365 | BrnT_toxin | 0.92 |
| PF00072 | Response_reg | 0.92 |
| PF01555 | N6_N4_Mtase | 0.92 |
| PF00196 | GerE | 0.92 |
| PF00731 | AIRC | 0.92 |
| PF01106 | NifU | 0.92 |
| PF01943 | Polysacc_synt | 0.92 |
| PF00923 | TAL_FSA | 0.92 |
| PF00175 | NAD_binding_1 | 0.92 |
| PF13183 | Fer4_8 | 0.92 |
| PF01661 | Macro | 0.92 |
| PF01596 | Methyltransf_3 | 0.92 |
| PF01743 | PolyA_pol | 0.92 |
| PF12732 | YtxH | 0.92 |
| PF01041 | DegT_DnrJ_EryC1 | 0.92 |
| PF02754 | CCG | 0.92 |
| PF00173 | Cyt-b5 | 0.92 |
| PF00909 | Ammonium_transp | 0.92 |
| PF00535 | Glycos_transf_2 | 0.92 |
| PF16363 | GDP_Man_Dehyd | 0.92 |
| PF01402 | RHH_1 | 0.92 |
| PF13620 | CarboxypepD_reg | 0.92 |
| PF11737 | DUF3300 | 0.92 |
| PF07238 | PilZ | 0.92 |
| PF01842 | ACT | 0.92 |
| PF05496 | RuvB_N | 0.92 |
| PF02954 | HTH_8 | 0.92 |
| PF07724 | AAA_2 | 0.92 |
| PF02806 | Alpha-amylase_C | 0.92 |
| PF05175 | MTS | 0.92 |
| PF16983 | MFS_MOT1 | 0.92 |
| PF00528 | BPD_transp_1 | 0.92 |
| PF03446 | NAD_binding_2 | 0.92 |
| PF16360 | GTP-bdg_M | 0.92 |
| PF09699 | Paired_CXXCH_1 | 0.92 |
| PF01061 | ABC2_membrane | 0.92 |
| PF02749 | QRPTase_N | 0.92 |
| PF07998 | Peptidase_M54 | 0.92 |
| PF13185 | GAF_2 | 0.92 |
| PF02656 | DUF202 | 0.92 |
| PF04909 | Amidohydro_2 | 0.92 |
| PF13633 | Obsolete Pfam Family | 0.92 |
| PF02594 | DUF167 | 0.92 |
| PF00330 | Aconitase | 0.92 |
| PF04216 | FdhE | 0.92 |
| PF00990 | GGDEF | 0.92 |
| PF09723 | Zn-ribbon_8 | 0.92 |
| PF13632 | Glyco_trans_2_3 | 0.92 |
| PF08352 | oligo_HPY | 0.92 |
| PF00227 | Proteasome | 0.92 |
| PF02518 | HATPase_c | 0.92 |
| PF13447 | Multi-haem_cyto | 0.92 |
| PF02416 | TatA_B_E | 0.92 |
| PF02576 | RimP_N | 0.92 |
| PF03720 | UDPG_MGDP_dh_C | 0.92 |
| PF13353 | Fer4_12 | 0.92 |
| PF03466 | LysR_substrate | 0.92 |
| PF12441 | CopG_antitoxin | 0.92 |
| PF02361 | CbiQ | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 1.83 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.83 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.83 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.83 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.83 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.83 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.83 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.92 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.92 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.92 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.92 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.92 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.92 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.92 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.92 |
| COG0617 | tRNA nucleotidyltransferase/poly(A) polymerase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0619 | ECF-type transporter transmembrane protein EcfT | Coenzyme transport and metabolism [H] | 0.92 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.92 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.92 |
| COG0779 | Ribosome maturation factor RimP | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.92 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.92 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.92 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.92 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.92 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.92 |
| COG1913 | Predicted Zn-dependent protease | General function prediction only [R] | 0.92 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.92 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.92 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.92 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.92 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.92 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.92 |
| COG3058 | Formate dehydrogenase maturation protein FdhE | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.81 % |
| Unclassified | root | N/A | 31.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000229|TB_LI09_3DRAFT_1124062 | Not Available | 529 | Open in IMG/M |
| 3300007959|Ga0079306_1187908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
| 3300009053|Ga0105095_10025138 | All Organisms → cellular organisms → Bacteria | 3207 | Open in IMG/M |
| 3300009053|Ga0105095_10026875 | All Organisms → cellular organisms → Bacteria | 3098 | Open in IMG/M |
| 3300009053|Ga0105095_10030738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 2891 | Open in IMG/M |
| 3300009053|Ga0105095_10043713 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 2410 | Open in IMG/M |
| 3300009053|Ga0105095_10054933 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300009053|Ga0105095_10105085 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300009053|Ga0105095_10107442 | Not Available | 1515 | Open in IMG/M |
| 3300009053|Ga0105095_10125362 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 1397 | Open in IMG/M |
| 3300009053|Ga0105095_10127371 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300009053|Ga0105095_10184708 | Not Available | 1141 | Open in IMG/M |
| 3300009053|Ga0105095_10202601 | Not Available | 1087 | Open in IMG/M |
| 3300009053|Ga0105095_10286522 | Not Available | 905 | Open in IMG/M |
| 3300009053|Ga0105095_10320364 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300009053|Ga0105095_10387902 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009053|Ga0105095_10662074 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300009053|Ga0105095_10685785 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 571 | Open in IMG/M |
| 3300009075|Ga0105090_10327664 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300009078|Ga0105106_10541845 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300009087|Ga0105107_10375146 | Not Available | 992 | Open in IMG/M |
| 3300009153|Ga0105094_10488016 | Not Available | 716 | Open in IMG/M |
| 3300009153|Ga0105094_10542512 | Not Available | 677 | Open in IMG/M |
| 3300009166|Ga0105100_10497048 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 743 | Open in IMG/M |
| 3300009166|Ga0105100_10513388 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 731 | Open in IMG/M |
| 3300009171|Ga0105101_10068443 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 1724 | Open in IMG/M |
| 3300009171|Ga0105101_10194411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 982 | Open in IMG/M |
| 3300009171|Ga0105101_10286114 | Not Available | 797 | Open in IMG/M |
| 3300009171|Ga0105101_10314674 | Not Available | 758 | Open in IMG/M |
| 3300009171|Ga0105101_10372627 | Not Available | 694 | Open in IMG/M |
| 3300010391|Ga0136847_10286551 | All Organisms → cellular organisms → Bacteria | 7123 | Open in IMG/M |
| 3300010391|Ga0136847_11081095 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 918 | Open in IMG/M |
| 3300010391|Ga0136847_12644746 | All Organisms → cellular organisms → Bacteria | 18195 | Open in IMG/M |
| 3300010391|Ga0136847_12875189 | All Organisms → cellular organisms → Bacteria | 7089 | Open in IMG/M |
| 3300012152|Ga0137347_1092348 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 540 | Open in IMG/M |
| 3300012931|Ga0153915_10068494 | All Organisms → cellular organisms → Bacteria | 3688 | Open in IMG/M |
| 3300012931|Ga0153915_10075037 | All Organisms → cellular organisms → Bacteria | 3531 | Open in IMG/M |
| 3300012931|Ga0153915_10146655 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2554 | Open in IMG/M |
| 3300012931|Ga0153915_10334057 | Not Available | 1700 | Open in IMG/M |
| 3300012931|Ga0153915_10663083 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1203 | Open in IMG/M |
| 3300012931|Ga0153915_10744692 | Not Available | 1134 | Open in IMG/M |
| 3300012931|Ga0153915_11184700 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_41_22 | 892 | Open in IMG/M |
| 3300012931|Ga0153915_11248213 | Not Available | 868 | Open in IMG/M |
| 3300012931|Ga0153915_11472664 | Not Available | 796 | Open in IMG/M |
| 3300012931|Ga0153915_11995253 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_41_22 | 679 | Open in IMG/M |
| 3300012931|Ga0153915_12633918 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 588 | Open in IMG/M |
| 3300012931|Ga0153915_12868856 | Not Available | 562 | Open in IMG/M |
| 3300012931|Ga0153915_13170362 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 534 | Open in IMG/M |
| 3300012931|Ga0153915_13245261 | Not Available | 528 | Open in IMG/M |
| 3300012931|Ga0153915_13481207 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012931|Ga0153915_13556667 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 504 | Open in IMG/M |
| 3300012964|Ga0153916_10217006 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300012964|Ga0153916_10520071 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 1262 | Open in IMG/M |
| 3300012964|Ga0153916_10615360 | Not Available | 1163 | Open in IMG/M |
| 3300012964|Ga0153916_10850002 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 993 | Open in IMG/M |
| 3300012964|Ga0153916_11827045 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 680 | Open in IMG/M |
| 3300012964|Ga0153916_12750968 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 555 | Open in IMG/M |
| 3300014324|Ga0075352_1243088 | Not Available | 551 | Open in IMG/M |
| 3300018070|Ga0184631_10095129 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 1155 | Open in IMG/M |
| 3300025164|Ga0209521_10385702 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300025167|Ga0209642_10049689 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
| 3300027713|Ga0209286_1313342 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 544 | Open in IMG/M |
| 3300027731|Ga0209592_1143632 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 858 | Open in IMG/M |
| 3300027731|Ga0209592_1235315 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 638 | Open in IMG/M |
| 3300027740|Ga0214474_1080444 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300030613|Ga0299915_10018344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5232 | Open in IMG/M |
| 3300030613|Ga0299915_10063955 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2714 | Open in IMG/M |
| 3300030613|Ga0299915_10187522 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300030613|Ga0299915_10812691 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 581 | Open in IMG/M |
| 3300030613|Ga0299915_10816777 | Not Available | 580 | Open in IMG/M |
| 3300031834|Ga0315290_10109035 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300031873|Ga0315297_10050512 | Not Available | 3149 | Open in IMG/M |
| 3300031873|Ga0315297_10197881 | Not Available | 1653 | Open in IMG/M |
| 3300031873|Ga0315297_11609141 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032156|Ga0315295_10147737 | Not Available | 2333 | Open in IMG/M |
| 3300032156|Ga0315295_11035191 | Not Available | 813 | Open in IMG/M |
| 3300032163|Ga0315281_10115689 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
| 3300032163|Ga0315281_10177392 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300032163|Ga0315281_10179226 | Not Available | 2378 | Open in IMG/M |
| 3300032342|Ga0315286_10708502 | Not Available | 1027 | Open in IMG/M |
| 3300032401|Ga0315275_10098985 | All Organisms → cellular organisms → Bacteria | 3194 | Open in IMG/M |
| 3300032516|Ga0315273_10023013 | All Organisms → cellular organisms → Bacteria | 8236 | Open in IMG/M |
| 3300032516|Ga0315273_10116667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_47_9 | 3653 | Open in IMG/M |
| 3300033486|Ga0316624_10015104 | All Organisms → cellular organisms → Bacteria | 4138 | Open in IMG/M |
| 3300033486|Ga0316624_10020501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3710 | Open in IMG/M |
| 3300033486|Ga0316624_10104042 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300033486|Ga0316624_10123919 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1875 | Open in IMG/M |
| 3300033486|Ga0316624_10152256 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1726 | Open in IMG/M |
| 3300033486|Ga0316624_10277036 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300033486|Ga0316624_10375087 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 1181 | Open in IMG/M |
| 3300033486|Ga0316624_11126928 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300033486|Ga0316624_11337481 | Not Available | 655 | Open in IMG/M |
| 3300033486|Ga0316624_11739656 | Not Available | 576 | Open in IMG/M |
| 3300033489|Ga0299912_10159463 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300033489|Ga0299912_10239635 | Not Available | 1545 | Open in IMG/M |
| 3300033489|Ga0299912_10249452 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300033489|Ga0299912_11340275 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 515 | Open in IMG/M |
| 3300033513|Ga0316628_100267060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2107 | Open in IMG/M |
| 3300033513|Ga0316628_100382995 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300033513|Ga0316628_100543778 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300033513|Ga0316628_100889261 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300033513|Ga0316628_101062964 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300033513|Ga0316628_101357488 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300034388|Ga0373907_090267 | Not Available | 724 | Open in IMG/M |
| 3300034414|Ga0373905_041093 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 688 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 29.36% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 20.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 14.68% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 5.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 3.67% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.83% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.92% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.92% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000229 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3 | Environmental | Open in IMG/M |
| 3300007959 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034388 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B3A4.2 | Engineered | Open in IMG/M |
| 3300034414 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_3DRAFT_11240621 | 3300000229 | Groundwater | PLTLALSLRGRGDYNWFLPLEGGGLGEGEMSILF* |
| Ga0079306_11879081 | 3300007959 | Deep Subsurface | MIPLTLALSLRGRGDYSWFLPIEVRLRRLVRTQADSPRRAEERGGLGEGEMSILFCDR* |
| Ga0105095_100251385 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDCSWFLPLEGGGLGEGEMSILF* |
| Ga0105095_100268753 | 3300009053 | Freshwater Sediment | MIPLTLAPSLQGRGDYSWFLPLEGGALREGEMSILF* |
| Ga0105095_100307385 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDYSWVLPLEGGGLGEGEISILF* |
| Ga0105095_100437133 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDFSWFLPLEGGGLGEGEISILF* |
| Ga0105095_100549333 | 3300009053 | Freshwater Sediment | MIPLTLPLSLQGRGDYSCFLPLEGGGLGEGEISILF* |
| Ga0105095_101050851 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEISILF |
| Ga0105095_101074421 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDYSLFLPLEGGGLGEGEMSILF* |
| Ga0105095_101253624 | 3300009053 | Freshwater Sediment | MIPLTLALSLQGRGDYNWFLPLEGGGLGEGEISILL* |
| Ga0105095_101273713 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDYSWFLPLEGRLRRLVRTQADSPRRAEERGGL |
| Ga0105095_101847082 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDYSWFLPHEGRLKRLAEERGGLGEGEISILF* |
| Ga0105095_102026011 | 3300009053 | Freshwater Sediment | MIPLTLALSLQGRGDYSWFLPVEGRLKRLAGERGGLGEGEISILF* |
| Ga0105095_102865221 | 3300009053 | Freshwater Sediment | MIPLTLPLSLQGRGDYSWSLPLEGGGLGEGEISILF* |
| Ga0105095_103203641 | 3300009053 | Freshwater Sediment | MIPLTLALSLQGRGEYSWFLPLEGGGLGEGEISILL* |
| Ga0105095_103517972 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDYSWFLSIEGSLKRLVRTQAASPRRAEE* |
| Ga0105095_103879022 | 3300009053 | Freshwater Sediment | MIPLTLALSLRGRGDYGCFLPLEGRLRRLAEERGGLEEGEMSILF* |
| Ga0105095_106620742 | 3300009053 | Freshwater Sediment | MIPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILL* |
| Ga0105095_106857852 | 3300009053 | Freshwater Sediment | MSPLTLALSLRGRGDYNWFLPLEGGGLGEGEMSILF* |
| Ga0105090_103276641 | 3300009075 | Freshwater Sediment | MNPLTLALSRKGRGDCSWFLPLEGGGLGEGETIPLLH* |
| Ga0105106_105418451 | 3300009078 | Freshwater Sediment | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEISILFLDC* |
| Ga0105107_103751462 | 3300009087 | Freshwater Sediment | MIPLTLALSLHGRGDYSWLLPLEGGGLGEGEISILF* |
| Ga0105094_104880161 | 3300009153 | Freshwater Sediment | MIPLTLALSLRERGDYSWFLPLEGGGLGEGEMSILF* |
| Ga0105094_105425122 | 3300009153 | Freshwater Sediment | MIPLTLALSLRGRGDYSWLLPLEGGGLGEGEMSIYFETVNN |
| Ga0105100_104970481 | 3300009166 | Freshwater Sediment | MIPLTLALSLRGEGIIAGSSPLGGGRMGEGEMSILF* |
| Ga0105100_105133882 | 3300009166 | Freshwater Sediment | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEISILV* |
| Ga0105101_100684432 | 3300009171 | Freshwater Sediment | MIPLTLALSLQGRGDFSWFLPLEGRLRRLVRTQADSPRRAEERGGLGEGEMSILF* |
| Ga0105101_101944111 | 3300009171 | Freshwater Sediment | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEISILF* |
| Ga0105101_102861142 | 3300009171 | Freshwater Sediment | PLTLALSLQGRGDYSWFLPLEGGGLGEGEISILL* |
| Ga0105101_103146742 | 3300009171 | Freshwater Sediment | MISLTLALSLQGRGDYSWFLPLEGGGLGEGEISILF* |
| Ga0105101_103726272 | 3300009171 | Freshwater Sediment | MIPLTLALSLQGRGDYSWFLPLEGGGLGEGEMSILF* |
| Ga0136847_102865512 | 3300010391 | Freshwater Sediment | MIPLTLPLSLQGRGDYSWFLPLEGGGLGEGEMSILF* |
| Ga0136847_110810952 | 3300010391 | Freshwater Sediment | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILFWDR* |
| Ga0136847_126447467 | 3300010391 | Freshwater Sediment | MIPLTLALSLRGRGDYSSFLPIEGGGLGEGEMSILF* |
| Ga0136847_128751891 | 3300010391 | Freshwater Sediment | MIPLTLALSLRGRGDYIWFFPLEGRLRRLVRTQADSPRRAEERRGLGEGEMSMLF* |
| Ga0137347_10923481 | 3300012152 | Soil | MIPLTLALSLRGRRDYSWFLPLEGGGLGEGELSILF* |
| Ga0153915_100684942 | 3300012931 | Freshwater Wetlands | MIPLTLALSLQGRGNYGWFLPLEGGGAGEGEISILF* |
| Ga0153915_100750373 | 3300012931 | Freshwater Wetlands | MIPLTLALSLRGRGDYNWFLPLGGGLGEGEMSILF* |
| Ga0153915_101466552 | 3300012931 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLTLEEGGLGEGEISILF* |
| Ga0153915_103340572 | 3300012931 | Freshwater Wetlands | MIPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILF* |
| Ga0153915_106630832 | 3300012931 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLPHEGGGLGEGEMLILF* |
| Ga0153915_107446922 | 3300012931 | Freshwater Wetlands | MIPLTLALSLRGRGDYSLFLPLEGGGLGEGEMSILL* |
| Ga0153915_111847001 | 3300012931 | Freshwater Wetlands | IPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILF* |
| Ga0153915_112482131 | 3300012931 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILFWNRY* |
| Ga0153915_114726642 | 3300012931 | Freshwater Wetlands | MIPLTLALSLQGRWDYSWFLPLEGGGLGEGEISTLF* |
| Ga0153915_119952532 | 3300012931 | Freshwater Wetlands | PLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILF* |
| Ga0153915_126339181 | 3300012931 | Freshwater Wetlands | MSPLTLALSLRGRWDYSWFLALEGRLRRLAEERRGLGEGEMSILL* |
| Ga0153915_128688561 | 3300012931 | Freshwater Wetlands | TLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEISILL* |
| Ga0153915_131703621 | 3300012931 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLALEGGGLGEGENVNTSLRLLICSVIPLY |
| Ga0153915_132452611 | 3300012931 | Freshwater Wetlands | LQGRGDYSWFLPLEGRLRRLAEERGGLGEGEISILF* |
| Ga0153915_134812072 | 3300012931 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLPLEGGGLGEVEMTILF* |
| Ga0153915_135566671 | 3300012931 | Freshwater Wetlands | MIPLTLALSLRGRGDYNWFLPLEGRGLGEGEMSILF* |
| Ga0153916_102170061 | 3300012964 | Freshwater Wetlands | MIPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEISILF* |
| Ga0153916_105200711 | 3300012964 | Freshwater Wetlands | MIPLTLALSLRGRGDYSCFLPLEGGGLGEGEMSILF* |
| Ga0153916_106153601 | 3300012964 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILFWNR* |
| Ga0153916_108500022 | 3300012964 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLTLEGGGLGEGEISILF* |
| Ga0153916_118270451 | 3300012964 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLPLEGRLRRLVRTQADSPRRAEERGGLGEGEMSILF* |
| Ga0153916_127509681 | 3300012964 | Freshwater Wetlands | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILF* |
| Ga0075352_12430882 | 3300014324 | Natural And Restored Wetlands | VNLSIPLTLALSLQGRGDYSWFLPLEGGGLGEGEMSILF* |
| Ga0184631_100951292 | 3300018070 | Groundwater Sediment | MIPLTLALSLQGRGDYRWFLPIEGRLRRLAKERGGLGEGEMSILF |
| Ga0209521_103857021 | 3300025164 | Soil | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILF |
| Ga0209642_100496892 | 3300025167 | Soil | MIPLTLALSLRGRGDYRWFLPLEGGALGEGEMSILF |
| Ga0209286_13133423 | 3300027713 | Freshwater Sediment | MIPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILF |
| Ga0209592_11436322 | 3300027731 | Freshwater Sediment | MIPLTLALSLQGRGEYSWFLPLEGGGLGEGEISILL |
| Ga0209592_12353152 | 3300027731 | Freshwater Sediment | MIPLTLALSLRGRGDFSWFLPLEGGGLGEGEISILF |
| Ga0214474_10804441 | 3300027740 | Soil | MIPLTLALSLQGRGDYSWLLPFEGRLRRLAEERGGLGEGEMSILFWNR |
| Ga0256868_101431341 | 3300027811 | Soil | GRGDYSWFLPLEGRLRRLVRTQADSPRRAEERGGLREGEMSILF |
| Ga0299915_100183443 | 3300030613 | Soil | MIPLTLALSSPGERDYSWSLPLEGRLRRLVRTQADSPRRAEERGGLGEGKMSILF |
| Ga0299915_100639553 | 3300030613 | Soil | MIPLTLALSLQGRGDYSWLLPFEGRLRRLAEERGGLGEGEMSILF |
| Ga0299915_101875221 | 3300030613 | Soil | MIPLIFALSLQGRGDYSWLLPLEGRLRRLAEERGGLGEGEMSILF |
| Ga0299915_108126911 | 3300030613 | Soil | MIPLTLALSLQGRGDYSWFLPLEGRLRRLVRTQADSPRRAEERGGLREGKMSI |
| Ga0299915_108167772 | 3300030613 | Soil | MIPLTLALSLRVRVDYSWFLPIEGRLRRLVRTQADSPRRAEERGGLGEGGMSILF |
| Ga0315290_101090354 | 3300031834 | Sediment | MIPLTLALSLQGRGDYIWSLPLEGGGLGKGEMSILF |
| Ga0315297_100505124 | 3300031873 | Sediment | MIPLTLALSLRGRGDYSWLLPLEGGGLGEGEMSILF |
| Ga0315297_101978811 | 3300031873 | Sediment | MITLTLALSLRGRGDYSWFLPIEGGGLGEGEMSILF |
| Ga0315297_116091412 | 3300031873 | Sediment | MTPLTLALSLQGRGDYSWFLPLEGGGLGEGEMSILF |
| Ga0315295_101477371 | 3300032156 | Sediment | MIPLTLALSLRGRGDYSWFLLIEGGGLGEGKMSILF |
| Ga0315295_110351912 | 3300032156 | Sediment | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSLLL |
| Ga0315281_101156892 | 3300032163 | Sediment | MIPLTLALSLRGRGGYSWFLPLEGGGLGEGKMSILF |
| Ga0315281_101773924 | 3300032163 | Sediment | MIPLTLALSLQGRGDYGWFLPLEGGGLGEGEMSILF |
| Ga0315281_101792261 | 3300032163 | Sediment | MIPLTLALSLRGRGDYIWFLPLDGGGLGEGEMSILF |
| Ga0315286_107085022 | 3300032342 | Sediment | MIPLPLALSLQGRGDYIWSLPLEGGGLGEGEMSILF |
| Ga0315275_100989853 | 3300032401 | Sediment | MIPLTLALSLRGRGYYNRFLPPERGGLGEGEMSILF |
| Ga0315273_100230131 | 3300032516 | Sediment | MIPLTLPLSLQGRGNYSWLLPLEGGGLGEGEMSILF |
| Ga0315273_101166674 | 3300032516 | Sediment | MIPLTLALSLQGRGDYNWFLPLEGRLRRLVRTQADSPRRAEERGGLGEGEMSILF |
| Ga0315273_102780481 | 3300032516 | Sediment | WFLPLEGSLRRLVRTQADSPRRAEERGGLGEGEMSILF |
| Ga0316624_100151044 | 3300033486 | Soil | MIPLTLALSLRGRGDYSWFLPLEGRLKRLAEERGGLGEGEISMLF |
| Ga0316624_100205015 | 3300033486 | Soil | MIPLTLALSLSLRGRGDYGWFLPLEGGGLGEGEMSILF |
| Ga0316624_101040423 | 3300033486 | Soil | MIPLTLALSLQGRGDYSWFLPLEGGGLGEGEMSILF |
| Ga0316624_101239191 | 3300033486 | Soil | MIPLTLALSLRGRGDYSWFLTLEEGGLGEGEISILF |
| Ga0316624_101522562 | 3300033486 | Soil | MIPLTLALSLQGRWDYSWFLPLEGGGLGEGEISTLF |
| Ga0316624_102770362 | 3300033486 | Soil | MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILFWNRY |
| Ga0316624_103750871 | 3300033486 | Soil | VSPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEMSILF |
| Ga0316624_111269281 | 3300033486 | Soil | MIPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEISILF |
| Ga0316624_113374811 | 3300033486 | Soil | MIPLTRALSLRGRGDYSWFLPLEGRLRRLAEERGGLGEG |
| Ga0316624_117396561 | 3300033486 | Soil | MIPLTLALSLRGRGDYRWFLPLEGGGLGEGEMSILF |
| Ga0299912_101594635 | 3300033489 | Soil | MEMNINSLIIEKTEMIPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLREGKMSILF |
| Ga0299912_102396351 | 3300033489 | Soil | VIIHLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEMSI |
| Ga0299912_102494522 | 3300033489 | Soil | MILLTLALSLRGRVDYSWFLPIEGRLRRLVRTQADSPRRAEERGGLGEGGMSILF |
| Ga0299912_112993392 | 3300033489 | Soil | RGDYSWFLPLDGRLRRLARTQADSPRRAEERGGLGEAEMSILF |
| Ga0299912_113402751 | 3300033489 | Soil | IPLIFALSLQGRGDYSWLLPLEGRLRRLAEERGGLGEGEMSILF |
| Ga0316628_1002670603 | 3300033513 | Soil | MIPLTLALSLRGRGDYSWFLPHEGGGLGEGEMLILFLDR |
| Ga0316628_1003829952 | 3300033513 | Soil | MIPLTLALSLQGRGNYGWFLPLEGGGLGEGEMSILF |
| Ga0316628_1005437782 | 3300033513 | Soil | MIPLTLALSLQGRGDYSWFLPLERGGLGEGEISILF |
| Ga0316628_1008892613 | 3300033513 | Soil | MIPLTLALSLRGRGDYSWFLPHEGGGLGEGEMLILF |
| Ga0316628_1010629643 | 3300033513 | Soil | VSPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEMSI |
| Ga0316628_1013574882 | 3300033513 | Soil | MIPLTLALSLQGRGDYNWFLPLKGGGLGEGEMSILFFETVNN |
| Ga0373907_090267_433_570 | 3300034388 | Sediment Slurry | MIPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEMSILF |
| Ga0373905_041093_494_667 | 3300034414 | Sediment Slurry | MIPLTLALSLRGRGDYRWFLPLEGRLRRLAEERGGLGEGEMSYYFETVNKCITRNRT |
| ⦗Top⦘ |