


| Basic Information | |
|---|---|
| Family ID | F087950 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPG |
| Number of Associated Samples | 56 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 56.48 % |
| % of genes near scaffold ends (potentially truncated) | 80.91 % |
| % of genes from short scaffolds (< 2000 bps) | 83.64 % |
| Associated GOLD sequencing projects | 48 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.636 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment (16.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (39.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00730 | HhH-GPD | 3.64 |
| PF00724 | Oxidored_FMN | 2.73 |
| PF01546 | Peptidase_M20 | 1.82 |
| PF09853 | DUF2080 | 1.82 |
| PF00654 | Voltage_CLC | 1.82 |
| PF01594 | AI-2E_transport | 1.82 |
| PF08359 | TetR_C_4 | 1.82 |
| PF07690 | MFS_1 | 1.82 |
| PF00441 | Acyl-CoA_dh_1 | 1.82 |
| PF13491 | FtsK_4TM | 1.82 |
| PF01297 | ZnuA | 0.91 |
| PF01925 | TauE | 0.91 |
| PF02844 | GARS_N | 0.91 |
| PF04365 | BrnT_toxin | 0.91 |
| PF00206 | Lyase_1 | 0.91 |
| PF00582 | Usp | 0.91 |
| PF00496 | SBP_bac_5 | 0.91 |
| PF01037 | AsnC_trans_reg | 0.91 |
| PF00149 | Metallophos | 0.91 |
| PF00497 | SBP_bac_3 | 0.91 |
| PF00293 | NUDIX | 0.91 |
| PF01975 | SurE | 0.91 |
| PF01661 | Macro | 0.91 |
| PF12787 | EcsC | 0.91 |
| PF02410 | RsfS | 0.91 |
| PF07796 | DUF1638 | 0.91 |
| PF07992 | Pyr_redox_2 | 0.91 |
| PF13090 | PP_kinase_C | 0.91 |
| PF13174 | TPR_6 | 0.91 |
| PF02073 | Peptidase_M29 | 0.91 |
| PF04290 | DctQ | 0.91 |
| PF00266 | Aminotran_5 | 0.91 |
| PF08668 | HDOD | 0.91 |
| PF02826 | 2-Hacid_dh_C | 0.91 |
| PF16347 | DUF4976 | 0.91 |
| PF02457 | DAC | 0.91 |
| PF01558 | POR | 0.91 |
| PF12728 | HTH_17 | 0.91 |
| PF08173 | YbgT_YccB | 0.91 |
| PF01850 | PIN | 0.91 |
| PF07969 | Amidohydro_3 | 0.91 |
| PF00248 | Aldo_ket_red | 0.91 |
| PF03190 | Thioredox_DsbH | 0.91 |
| PF16925 | TetR_C_13 | 0.91 |
| PF02776 | TPP_enzyme_N | 0.91 |
| PF02665 | Nitrate_red_gam | 0.91 |
| PF05221 | AdoHcyase | 0.91 |
| PF01261 | AP_endonuc_2 | 0.91 |
| PF01012 | ETF | 0.91 |
| PF08352 | oligo_HPY | 0.91 |
| PF06253 | MTTB | 0.91 |
| PF05544 | Pro_racemase | 0.91 |
| PF13447 | Multi-haem_cyto | 0.91 |
| PF00815 | Histidinol_dh | 0.91 |
| PF08734 | GYD | 0.91 |
| PF13188 | PAS_8 | 0.91 |
| PF13193 | AMP-binding_C | 0.91 |
| PF13378 | MR_MLE_C | 0.91 |
| PF02873 | MurB_C | 0.91 |
| PF13185 | GAF_2 | 0.91 |
| PF01039 | Carboxyl_trans | 0.91 |
| PF11870 | LutB_C | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 3.64 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 3.64 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 3.64 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 3.64 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 3.64 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 2.73 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 2.73 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 1.82 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.82 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 1.82 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.82 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.91 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.91 |
| COG0496 | Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE | Replication, recombination and repair [L] | 0.91 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.91 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.91 |
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.91 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.91 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.91 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.91 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.91 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG2181 | Nitrate reductase gamma subunit | Energy production and conversion [C] | 0.91 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.91 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.91 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.91 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.91 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.91 |
| COG4890 | Predicted outer membrane lipoprotein | Function unknown [S] | 0.91 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.55 % |
| Unclassified | root | N/A | 15.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001371|BBDRAFT_10439711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 592 | Open in IMG/M |
| 3300004023|Ga0055441_10044408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 994 | Open in IMG/M |
| 3300004026|Ga0055443_10134189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44 | 734 | Open in IMG/M |
| 3300004029|Ga0055442_10315011 | Not Available | 540 | Open in IMG/M |
| 3300005589|Ga0070729_10727820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 531 | Open in IMG/M |
| 3300005590|Ga0070727_10331500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 847 | Open in IMG/M |
| 3300005612|Ga0070723_10299469 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005612|Ga0070723_10714308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 509 | Open in IMG/M |
| 3300005830|Ga0074473_10285092 | All Organisms → cellular organisms → Archaea | 3246 | Open in IMG/M |
| 3300005920|Ga0070725_10397499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 613 | Open in IMG/M |
| 3300006467|Ga0099972_10604079 | Not Available | 564 | Open in IMG/M |
| 3300006467|Ga0099972_11395754 | Not Available | 560 | Open in IMG/M |
| 3300006467|Ga0099972_12530492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1236 | Open in IMG/M |
| 3300006467|Ga0099972_12595936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 968 | Open in IMG/M |
| 3300007102|Ga0102541_1049292 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300007102|Ga0102541_1249285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 690 | Open in IMG/M |
| 3300007102|Ga0102541_1443201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1356 | Open in IMG/M |
| 3300007784|Ga0102955_1207095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44 | 560 | Open in IMG/M |
| 3300008409|Ga0114885_10160 | All Organisms → cellular organisms → Bacteria | 6822 | Open in IMG/M |
| 3300009033|Ga0102956_1013638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 2467 | Open in IMG/M |
| 3300009033|Ga0102956_1034445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1557 | Open in IMG/M |
| 3300009060|Ga0102962_1045619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 1258 | Open in IMG/M |
| 3300009138|Ga0102959_1030823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. | 1400 | Open in IMG/M |
| 3300009138|Ga0102959_1064193 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300009138|Ga0102959_1090193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300009145|Ga0102961_1043519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1042 | Open in IMG/M |
| 3300009145|Ga0102961_1044504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1032 | Open in IMG/M |
| 3300010392|Ga0118731_102221299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 535 | Open in IMG/M |
| 3300010392|Ga0118731_102926321 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp. | 1604 | Open in IMG/M |
| 3300010392|Ga0118731_103282086 | Not Available | 1030 | Open in IMG/M |
| 3300010392|Ga0118731_103578162 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010392|Ga0118731_105000208 | Not Available | 631 | Open in IMG/M |
| 3300010392|Ga0118731_105376354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 648 | Open in IMG/M |
| 3300010430|Ga0118733_109001484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 515 | Open in IMG/M |
| 3300014903|Ga0164321_10405164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 672 | Open in IMG/M |
| 3300019712|Ga0193969_1064997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 500 | Open in IMG/M |
| 3300019721|Ga0194011_1012083 | Not Available | 834 | Open in IMG/M |
| 3300019739|Ga0194012_1010975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 927 | Open in IMG/M |
| 3300021351|Ga0210365_10597325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2630 | Open in IMG/M |
| 3300021351|Ga0210365_10683047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 564 | Open in IMG/M |
| 3300022202|Ga0224498_10034276 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300022202|Ga0224498_10040787 | Not Available | 1300 | Open in IMG/M |
| 3300022202|Ga0224498_10066683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1023 | Open in IMG/M |
| 3300022217|Ga0224514_10012709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2661 | Open in IMG/M |
| 3300022217|Ga0224514_10186475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 737 | Open in IMG/M |
| 3300022217|Ga0224514_10217716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 684 | Open in IMG/M |
| 3300022217|Ga0224514_10270153 | Not Available | 617 | Open in IMG/M |
| 3300022217|Ga0224514_10394186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 514 | Open in IMG/M |
| 3300022217|Ga0224514_10395144 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300022218|Ga0224502_10013803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2956 | Open in IMG/M |
| 3300022218|Ga0224502_10018953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2540 | Open in IMG/M |
| 3300022218|Ga0224502_10023292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2295 | Open in IMG/M |
| 3300022218|Ga0224502_10066311 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300022218|Ga0224502_10127457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 971 | Open in IMG/M |
| 3300022220|Ga0224513_10098775 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300022220|Ga0224513_10424162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 538 | Open in IMG/M |
| 3300022306|Ga0224509_10366309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 528 | Open in IMG/M |
| 3300022308|Ga0224504_10353691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 610 | Open in IMG/M |
| 3300022391|Ga0210374_1003966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1937 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10050962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1568 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10345558 | Not Available | 639 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10467238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 522 | Open in IMG/M |
| 3300025566|Ga0210140_1039893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44 | 871 | Open in IMG/M |
| 3300025974|Ga0210118_1034095 | Not Available | 771 | Open in IMG/M |
| 3300025974|Ga0210118_1045348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300025983|Ga0210106_1012239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1314 | Open in IMG/M |
| 3300025991|Ga0210128_1043613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 720 | Open in IMG/M |
| 3300026099|Ga0209920_1047674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 545 | Open in IMG/M |
| 3300026126|Ga0209957_1018356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1481 | Open in IMG/M |
| 3300026131|Ga0209928_1019347 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300027820|Ga0209578_10564737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 506 | Open in IMG/M |
| 3300027828|Ga0209692_10115629 | Not Available | 1299 | Open in IMG/M |
| 3300027845|Ga0209271_10063915 | Not Available | 1528 | Open in IMG/M |
| 3300027845|Ga0209271_10146050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 971 | Open in IMG/M |
| 3300027845|Ga0209271_10241874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 729 | Open in IMG/M |
| 3300027845|Ga0209271_10250845 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10006904 | All Organisms → cellular organisms → Bacteria | 7189 | Open in IMG/M |
| 3300027917|Ga0209536_100061711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4863 | Open in IMG/M |
| 3300028600|Ga0265303_10927271 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300032136|Ga0316201_10278050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1450 | Open in IMG/M |
| 3300032136|Ga0316201_10583068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 956 | Open in IMG/M |
| 3300032231|Ga0316187_10015474 | All Organisms → cellular organisms → Bacteria | 6377 | Open in IMG/M |
| 3300032231|Ga0316187_10211325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1496 | Open in IMG/M |
| 3300032231|Ga0316187_11104729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300032251|Ga0316198_10751115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 520 | Open in IMG/M |
| 3300032252|Ga0316196_10258661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300032252|Ga0316196_10350713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 636 | Open in IMG/M |
| 3300032258|Ga0316191_10109615 | Not Available | 2022 | Open in IMG/M |
| 3300032258|Ga0316191_10112898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1989 | Open in IMG/M |
| 3300032258|Ga0316191_10130086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1841 | Open in IMG/M |
| 3300032258|Ga0316191_10731910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300032259|Ga0316190_10059221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2716 | Open in IMG/M |
| 3300032259|Ga0316190_10303317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1093 | Open in IMG/M |
| 3300032259|Ga0316190_10615056 | Not Available | 725 | Open in IMG/M |
| 3300032260|Ga0316192_10230570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1282 | Open in IMG/M |
| 3300032260|Ga0316192_10278949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1152 | Open in IMG/M |
| 3300032260|Ga0316192_10966082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 570 | Open in IMG/M |
| 3300032262|Ga0316194_10087002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2022 | Open in IMG/M |
| 3300032262|Ga0316194_10241554 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium DG_61 | 1151 | Open in IMG/M |
| 3300032262|Ga0316194_10264284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1095 | Open in IMG/M |
| 3300032262|Ga0316194_10760320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 610 | Open in IMG/M |
| 3300032262|Ga0316194_10874442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 566 | Open in IMG/M |
| 3300032272|Ga0316189_10094579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans | 2448 | Open in IMG/M |
| 3300032272|Ga0316189_10391101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1076 | Open in IMG/M |
| 3300033429|Ga0316193_10156394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1799 | Open in IMG/M |
| 3300033429|Ga0316193_10389125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1108 | Open in IMG/M |
| 3300033429|Ga0316193_10654341 | Not Available | 837 | Open in IMG/M |
| 3300033429|Ga0316193_10821139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 740 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 16.36% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 15.45% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 12.73% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 10.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.91% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 9.09% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.27% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.73% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.73% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.73% |
| Marine Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment | 2.73% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.82% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.91% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.91% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
| 3300004023 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 | Environmental | Open in IMG/M |
| 3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
| 3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007102 | Combined Assembly of Marine Sediment Inoculum and Enrichments | Engineered | Open in IMG/M |
| 3300007784 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG | Environmental | Open in IMG/M |
| 3300008409 | Coastal sediment microbial communities from intertidal sand flat, Janssand, Germany_1868_binC | Environmental | Open in IMG/M |
| 3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
| 3300009060 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MG | Environmental | Open in IMG/M |
| 3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
| 3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300019712 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_5-6_MG | Environmental | Open in IMG/M |
| 3300019721 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MG | Environmental | Open in IMG/M |
| 3300019739 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MG | Environmental | Open in IMG/M |
| 3300021351 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022391 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025566 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025974 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025983 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025991 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026099 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026126 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026131 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBDRAFT_104397111 | 3300001371 | Marine Estuarine | MQCWINGPTTGGIDDKIKMAIILLTTNIPAFHYSIIPFSG |
| Ga0055441_100444081 | 3300004023 | Natural And Restored Wetlands | MQCWINGPAGGIDDKIQMANILLKTNIPTFHHSIIPFRGKFGSTKKPL |
| Ga0055443_101341891 | 3300004026 | Natural And Restored Wetlands | MGFGMMQCWINGSATGGSDDNIKMVNILLKTNIPSFHPSII |
| Ga0055442_103150112 | 3300004029 | Natural And Restored Wetlands | MQCWINDLATGGIDDKIKMAIILLKTNIPVFHHSIIPFPGQIRKP* |
| Ga0070729_107278201 | 3300005589 | Marine Sediment | MQCWINGPATGGIDDKIKMAIILLKTNIPAFHHSIIPFSGQI |
| Ga0070727_103315001 | 3300005590 | Marine Sediment | MQCWINGSATGGIDDKIKMVNILLKTNIPSFHPSIIPFPG |
| Ga0070723_102994691 | 3300005612 | Marine Sediment | MQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPG |
| Ga0070723_107143081 | 3300005612 | Marine Sediment | MVSGVMQCWINVPATDGIEDKIKMAFFLLKTNIPAFHHSIIPFSGQIRNPK* |
| Ga0074473_102850923 | 3300005830 | Sediment (Intertidal) | MMMQCWVNGPANDAIGDKIKMAYILLKTNIPSFQHSIIPFSGQI* |
| Ga0074473_106001835 | 3300005830 | Sediment (Intertidal) | MQCWINGPATDGIDEKIKMASILLKTNIPTFLHFIIPFSGQIRKPQKNLYILSRL* |
| Ga0070725_103974992 | 3300005920 | Marine Sediment | MQYWINGPATGGIDDKIKMANILLKTNIPSFQYSIIPFSGQI |
| Ga0099972_106040792 | 3300006467 | Marine | MGSGMMQCWINGPATGGIDDKLKMVNILLKTNIPSFHPSIIPF |
| Ga0099972_113957541 | 3300006467 | Marine | TDGIEDKIKMAFFLLKTNIPAFHHSIIPFSGQIRNPK* |
| Ga0099972_125304922 | 3300006467 | Marine | MGSGIMQCWINGPATGGIDDKIKMAIILLKTNIPGFH |
| Ga0099972_125959361 | 3300006467 | Marine | MGSGIMQYWINGPATGGIDDKIKMANILLKTNIPS |
| Ga0102541_10492921 | 3300007102 | Marine Sediment | PCWMNGPATDGIDDKLKTVNILLKTNIPLFHCSIIPIVSEAN* |
| Ga0102541_12492852 | 3300007102 | Marine Sediment | MQCWINVPATGGNDDKIKMANILLKTNIPAFHHSIIPFSEQIRKPQN |
| Ga0102541_14432012 | 3300007102 | Marine Sediment | MGFGMMQCLINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPG |
| Ga0102955_12070951 | 3300007784 | Soil | MGFGMMQCWINGSATGGSDDNIKMVNILLKTNIPS |
| Ga0114885_101603 | 3300008409 | Sediment | MQYWINGPASGGIDDKIKMVNILLKTNIPSFHHSIIPFPG* |
| Ga0102956_10136381 | 3300009033 | Soil | MQCWINDLATGGIDDKIKMAIILLKTNIPVFHHSIIPFSGQIRK |
| Ga0102956_10344451 | 3300009033 | Soil | GMMQCWINGPATGGIDDKIKRVNILLKTNIPSFHPSIIPFPGQIRMPQKNLFILSRL* |
| Ga0102962_10456191 | 3300009060 | Soil | QCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ* |
| Ga0102959_10308231 | 3300009138 | Soil | GIMGFGIMQCRINGKIHIDDKIKMVKILLKTNIPSFHHSIIPFPRQIRKP* |
| Ga0102959_10641932 | 3300009138 | Soil | MGFGMMQCWINGPATGGIDDKIKMVNIILKTNIPSFHPSIIPFPGQIQNPKKPPYSQ* |
| Ga0102959_10901932 | 3300009138 | Soil | MMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQK |
| Ga0102961_10435192 | 3300009145 | Soil | ATSGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ* |
| Ga0102961_10445042 | 3300009145 | Soil | MGSGIMQCWIDGSASGGIDGNIKMAIILLKTNIPA |
| Ga0118731_1022212992 | 3300010392 | Marine | MGSGMMKCWNNGPATGGIDDKIKMVNILLKTNIPSFHHSIIPFPGQI* |
| Ga0118731_1029263213 | 3300010392 | Marine | MQCWINGPATGGIDDKIKMANILLKTNIPSFQYSIIPFSGQIR |
| Ga0118731_1032820862 | 3300010392 | Marine | MQCWINGPATGGIDDKIKMVNILLKTNIPVFHHSIIPFSGQIRK* |
| Ga0118731_1035781622 | 3300010392 | Marine | MGSGIMQCWSNGPATGGIDDKIKMAIILLKTNIPVIHHSII |
| Ga0118731_1050002081 | 3300010392 | Marine | MQFWVNGSAKGGIDDKIKRTNILLKTNIPSFHHSIIPFPG |
| Ga0118731_1053763542 | 3300010392 | Marine | MQCWINGPATGGIDDKIKMTNILLKTNIPAFHHSIIPFSGKIRKSQK |
| Ga0118733_1090014841 | 3300010430 | Marine Sediment | MQCWINGPATGGIDDKIKMAIILLKTNIPACHYSIIPFPGQIRKPQKT |
| Ga0164321_104051642 | 3300014903 | Marine Sediment | MQFWINGPATGGIDDKIKMANILLNTNIPSFHHSIIPFLGQIRKPKK |
| Ga0193969_10649972 | 3300019712 | Sediment | MQCWINGPATGGIDDKIKMAIILLKTNIPAFHHSIIPFS |
| Ga0194011_10120832 | 3300019721 | Sediment | MQCWINGPATGGIEGKIIMAIILLKTNIPAFHYSSFGA |
| Ga0194012_10109751 | 3300019739 | Sediment | MGFGKMQCWANGPATEGIGDKIKIAYILLRTNFPEFHHSIIPFSGQI |
| Ga0210365_105973254 | 3300021351 | Estuarine | MQCWIDNPATGGIDEKIKMASILLKTNIPTFHHFINPFSGQIRKLQKKPLYSQ |
| Ga0210365_106830471 | 3300021351 | Estuarine | MQCWINGPATSGIDDKIKMAIILLKTNIPAFHHSIIPFSGQIRTPQKISISS |
| Ga0224498_100342761 | 3300022202 | Sediment | MGFGMMQCWINGPATGGIDDKIKMVNIILKTNIPSFHPSIIPFPGQIQNPKKPPYSQ |
| Ga0224498_100407872 | 3300022202 | Sediment | MGSGIMQCWINGPATGGIDDKIKMAIILLKINIPAFHHSIIPF |
| Ga0224498_100666832 | 3300022202 | Sediment | MGFGMMQCLINAPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPK |
| Ga0224514_100127091 | 3300022217 | Sediment | MMQCWINGPATGGIDDKIKRVNILLKTNIPSFHPSIIPFPGQIRMPQKNLFILSRL |
| Ga0224514_101864751 | 3300022217 | Sediment | MQCWIDEPITGKIDDKITMAIILLETNIPAFHHSIIPFSGQIRKPQNTYIFSVGC |
| Ga0224514_102177161 | 3300022217 | Sediment | MQCWINGPATGGIDDKIKMAIILLTTNIPAFQHSTI |
| Ga0224514_102701532 | 3300022217 | Sediment | TGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ |
| Ga0224514_103941861 | 3300022217 | Sediment | MQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQK |
| Ga0224514_103951441 | 3300022217 | Sediment | MQCWINGPAAGGIDDKIKIAIILFKTNIPVFHHSIIPFSGQIRKFRKNH |
| Ga0224502_100138034 | 3300022218 | Sediment | NGPATGGIDDKLKMVNILLKTNIPAFHPSIIPFPG |
| Ga0224502_100189532 | 3300022218 | Sediment | MQCLINGPATGGIDDKIKMVKILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ |
| Ga0224502_100232921 | 3300022218 | Sediment | MQCWINDPATGGIDDKIKMAIILWENNIPAFHHSIIPFS |
| Ga0224502_100663112 | 3300022218 | Sediment | MQCWINGPATSGIGDKIKMVNILLKTNIPSFHPSIIPFPGQIRKSQ |
| Ga0224502_101274573 | 3300022218 | Sediment | MQCWINGPATGAIDDKIKMVDILLKTNIPSFHPSI |
| Ga0224513_100987752 | 3300022220 | Sediment | MGFGMMQCWINGPATSGIGDKIKMVNILLKTNIPSFHPSIIPFPGQ |
| Ga0224513_104241621 | 3300022220 | Sediment | MGSGMMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPS |
| Ga0224509_103663092 | 3300022306 | Sediment | TGGIDYKIKMAIILWKNNIPAFHHSIIPFSGQIRKP |
| Ga0224504_103536911 | 3300022308 | Sediment | GMVQCWINGPATSGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ |
| Ga0210374_10039662 | 3300022391 | Estuarine | MQCWINGPATGGIDDKIKMVNILLKTNIPAFHPSIIPFPGKIRKSQKSPILSIDC |
| (restricted) Ga0255039_100509623 | 3300024062 | Seawater | MQCWINCPATSGIDDKVIMANILLKTNIPSFHHSITPF |
| (restricted) Ga0255039_103455582 | 3300024062 | Seawater | MQCWINGPATGVIDDKIKMANILLKTNIPAFHHSIIPFPEQIRKPQNNF |
| (restricted) Ga0255045_104672381 | 3300024528 | Seawater | MQCWINGPATDGNADKNKMAYILLKTNIPAFHHSITPFSG |
| Ga0210140_10398931 | 3300025566 | Natural And Restored Wetlands | MGFGMMQCWINGSATGGSDDNIKMVNILLKTNIPSFHPSIIPFPGEI |
| Ga0210118_10340953 | 3300025974 | Natural And Restored Wetlands | MGSGIMQCWINGPATGRIDDKIKMAIILLKTNIPAFHHSVIPFLG |
| Ga0210118_10453482 | 3300025974 | Natural And Restored Wetlands | LINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ |
| Ga0210106_10122392 | 3300025983 | Natural And Restored Wetlands | MQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQKTSIL |
| Ga0210128_10436131 | 3300025991 | Natural And Restored Wetlands | MQCWINGPATGGIDDKIKMAIILLKTNIPAFHHSIIPFSGPIRKPQ |
| Ga0209920_10476742 | 3300026099 | Soil | MGSGMVQCWINGPATSGIDDKIKMVNILLKTNIPSFHPSIIPFPGQI |
| Ga0209957_10183563 | 3300026126 | Soil | MQCWINGPATDGIDDKIKMANILLKTNIPPFHYSISGANS |
| Ga0209928_10193472 | 3300026131 | Soil | MQCWINGPATGGIDDKIKMAIILLKTNIPAFHHSIIPF |
| Ga0209578_105647371 | 3300027820 | Marine Sediment | MGSGMMQCWINGPATGGIDDKIKMANILLKTNIPSFHHSIIPFPGQIRR |
| Ga0209692_101156292 | 3300027828 | Marine Sediment | ERMMQSWINGPATGGIDDKIKMVNILFKTNIPSLHYSIIPFPRQIRKP |
| Ga0209271_100639152 | 3300027845 | Marine Sediment | MQCWINGSATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGQIRRP |
| Ga0209271_101460501 | 3300027845 | Marine Sediment | MQCWINGLATGGFDDKIKMANILLKTNIPSFQYSIIPFSGQIREPQKISIFS |
| Ga0209271_102418741 | 3300027845 | Marine Sediment | MQCWINGPATGGIDVKIKMANILLKTNIPSFQYSIIPFSGQIRKP |
| Ga0209271_102508451 | 3300027845 | Marine Sediment | MQCWINDPATGGIDDKLKMVNILLKTNIPSFHPSIIPFPGQIRRPQKTSIFSV |
| (restricted) Ga0255055_100069044 | 3300027881 | Seawater | MQCWINVPATNGIDDKIKMAYILLKTNIPEFHHSIIPFSWQFRNPK |
| Ga0209536_1000617112 | 3300027917 | Marine Sediment | MMECWIDNPARGEIEDKIKMATIRLKTNIPSFQHSNIPFSIQIW |
| Ga0265303_109272712 | 3300028600 | Sediment | MQCWINGPAIDGIDDKIKMAYILLKTNIPTFHHSNIPFSG |
| Ga0316201_102780503 | 3300032136 | Worm Burrow | MGSGMMQCWINGPATGGIDDKIKMVNILLKTNIPSFHLSIIPFPGQIRRPQKTSIFS |
| Ga0316201_105830683 | 3300032136 | Worm Burrow | MQCWINGPATGGIDDKLKMVNILLKTNIPAFHPSIIPFPGQIRRPQ |
| Ga0316187_100154743 | 3300032231 | Worm Burrow | MQYLINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPQKSPYSQ |
| Ga0316187_102113251 | 3300032231 | Worm Burrow | MGFGMMQCLINGPAAGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQK |
| Ga0316187_111047292 | 3300032231 | Worm Burrow | MVQCWINGPATSGIDDKIKMVNILLKTNIPSFHPSI |
| Ga0316198_107511152 | 3300032251 | Sediment | MQCCNNGPATGGIDDKTKMANILLKTNIPVFHHSIIPF |
| Ga0316196_100465493 | 3300032252 | Sediment | MQCWINGPATDGINGKILMAIILLKTNIPAFHHSIIPFSRQIRKPPKTSI |
| Ga0316196_102586611 | 3300032252 | Sediment | MGFGMMQCLINGPAAGGIDDKIKMVNILLKTNIPSFHPSIIPF |
| Ga0316196_103507131 | 3300032252 | Sediment | MQYWINGPVLGGIDDKIKMAIILLKTNIPAFHHSIIPFSG |
| Ga0316191_101096151 | 3300032258 | Worm Burrow | MQCWINGPSTGEIDDKIKMAIILLKTNIPAFHYSII |
| Ga0316191_101128983 | 3300032258 | Worm Burrow | MQCWINGPATGGIDDKLKMVNILLKTNIPAFHPSIIPFPG |
| Ga0316191_101300861 | 3300032258 | Worm Burrow | MQCLINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPEKIRRPKKSPYSQ |
| Ga0316191_107319101 | 3300032258 | Worm Burrow | MGFGMMQCLINGPAAGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKP |
| Ga0316190_100592214 | 3300032259 | Worm Burrow | VGSGMMQCWINGPATGGIEDKIKMVNILLKTNNPSFHPSIIPFPGK |
| Ga0316190_103033171 | 3300032259 | Worm Burrow | MQYLINGPASGGIDDKLKMVNILLKTNVPAFHSSIIPF |
| Ga0316190_106150562 | 3300032259 | Worm Burrow | MQCWINNPAAVGIDDKIKIAIILLKTNIPAFHHSIIPFPGQ |
| Ga0316192_102305701 | 3300032260 | Worm Burrow | MQCWINVPATGRVDDNIKMANILLKTNIPSFHRSIV |
| Ga0316192_102789492 | 3300032260 | Worm Burrow | MQCWINGPATGGSDDNIKMVNILLKTNILAFHPSMIPISGQI |
| Ga0316192_109660821 | 3300032260 | Worm Burrow | MQCWINGITTGGIDVKIKMAIFLLKTNIPAFHHSIIPFSGQIRKLKNT |
| Ga0316194_100870021 | 3300032262 | Sediment | MMQCWINGPATGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQKTSILSVGC |
| Ga0316194_102415542 | 3300032262 | Sediment | MQCWINGPAAVGIDDKIKIAISLLKTNIPAFHHSIIPFPGQIRKPQ |
| Ga0316194_102642841 | 3300032262 | Sediment | MQCWINGSAAVGIDDKIKIAIILLKTNIPAFHHSIIPFPGQIRKPQKTS |
| Ga0316194_107603202 | 3300032262 | Sediment | MQCWINVPATSGIDDKIKMVIILLKTNIPAFHPSIIPF |
| Ga0316194_108744422 | 3300032262 | Sediment | MGSEIMQYXINGPATGGIDGKIIIAIIVLKTNIPAFHHSI |
| Ga0316189_100945792 | 3300032272 | Worm Burrow | MQCWINGPATGGINDKIQMVTIILKTNIPSFHPCIIPFPGQIRKPQKNLHILSRL |
| Ga0316189_103911013 | 3300032272 | Worm Burrow | MMGFGMMQCLINGPAAGGIDDKIKMVNILLKTNIPSFHPSIIPFPGKIRKPQKIS |
| Ga0316193_101563941 | 3300033429 | Sediment | WINGPATGGIDDKLKMVNILLKTNIPAFHPSIIPFPR |
| Ga0316193_103891251 | 3300033429 | Sediment | MQYLINGPASGGIDDKLKMVNILLKTNVPAFHSSIIPFLGHIQRPQ |
| Ga0316193_106543412 | 3300033429 | Sediment | MKCWVNGPATGGIDDKIKIAIILLKTNIPVFHYSIF |
| Ga0316193_108211392 | 3300033429 | Sediment | MQCWINGPAADEIDDNINRAYILLKTNIPAFHHPIIPF |
| ⦗Top⦘ |