


| Basic Information | |
|---|---|
| Family ID | F087925 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GVSLMTATPKPTEHLTVDVEDPRTLTAAQRSSTIEEKWR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.45 % |
| % of genes near scaffold ends (potentially truncated) | 90.91 % |
| % of genes from short scaffolds (< 2000 bps) | 99.09 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.455 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.39% β-sheet: 0.00% Coil/Unstructured: 77.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00664 | ABC_membrane | 44.55 |
| PF08402 | TOBE_2 | 5.45 |
| PF00005 | ABC_tran | 3.64 |
| PF02615 | Ldh_2 | 2.73 |
| PF02776 | TPP_enzyme_N | 2.73 |
| PF01663 | Phosphodiest | 1.82 |
| PF04392 | ABC_sub_bind | 0.91 |
| PF05378 | Hydant_A_N | 0.91 |
| PF00486 | Trans_reg_C | 0.91 |
| PF02900 | LigB | 0.91 |
| PF13620 | CarboxypepD_reg | 0.91 |
| PF00848 | Ring_hydroxyl_A | 0.91 |
| PF00211 | Guanylate_cyc | 0.91 |
| PF05988 | DUF899 | 0.91 |
| PF03328 | HpcH_HpaI | 0.91 |
| PF04909 | Amidohydro_2 | 0.91 |
| PF12681 | Glyoxalase_2 | 0.91 |
| PF00069 | Pkinase | 0.91 |
| PF07883 | Cupin_2 | 0.91 |
| PF01425 | Amidase | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.64 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 2.73 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.82 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.82 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.91 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.91 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.91 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.91 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.91 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.45 % |
| Unclassified | root | N/A | 4.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000561|F21B_10694009 | Not Available | 563 | Open in IMG/M |
| 3300001431|F14TB_100236530 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300004463|Ga0063356_105520692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300005186|Ga0066676_10585053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300005332|Ga0066388_102602016 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005436|Ga0070713_101943621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 571 | Open in IMG/M |
| 3300005467|Ga0070706_101935515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300005529|Ga0070741_10980732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 726 | Open in IMG/M |
| 3300005554|Ga0066661_10562279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300005614|Ga0068856_102600760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300005713|Ga0066905_102064926 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005764|Ga0066903_101619163 | Not Available | 1229 | Open in IMG/M |
| 3300005764|Ga0066903_102198636 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005764|Ga0066903_102257105 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005764|Ga0066903_102695810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 964 | Open in IMG/M |
| 3300005764|Ga0066903_105603698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter | 661 | Open in IMG/M |
| 3300005764|Ga0066903_105925778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300005891|Ga0075283_1103595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 535 | Open in IMG/M |
| 3300006032|Ga0066696_10094990 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300006034|Ga0066656_10680578 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
| 3300006800|Ga0066660_10171008 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300006853|Ga0075420_101238946 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300007265|Ga0099794_10660159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300009038|Ga0099829_10598020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300009089|Ga0099828_12014180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300009090|Ga0099827_11302390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300009100|Ga0075418_11839627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
| 3300009162|Ga0075423_12044819 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300009444|Ga0114945_10128627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1441 | Open in IMG/M |
| 3300010046|Ga0126384_11819502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300010047|Ga0126382_10365551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1112 | Open in IMG/M |
| 3300010335|Ga0134063_10619956 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010343|Ga0074044_10414556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. AU4i | 882 | Open in IMG/M |
| 3300010358|Ga0126370_12381266 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300010359|Ga0126376_10289917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1417 | Open in IMG/M |
| 3300010360|Ga0126372_10837607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300010360|Ga0126372_11157891 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300010361|Ga0126378_12155822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300010362|Ga0126377_12460786 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
| 3300010362|Ga0126377_12626504 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010366|Ga0126379_13537218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300010376|Ga0126381_104343142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300010398|Ga0126383_11079733 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010398|Ga0126383_13259024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 530 | Open in IMG/M |
| 3300012199|Ga0137383_10931801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300012212|Ga0150985_102151548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300012361|Ga0137360_10592168 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 949 | Open in IMG/M |
| 3300012362|Ga0137361_11172560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300012469|Ga0150984_109440301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300012532|Ga0137373_10417114 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300012925|Ga0137419_10475609 | Not Available | 988 | Open in IMG/M |
| 3300012925|Ga0137419_11380655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300012929|Ga0137404_11986701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300012971|Ga0126369_10576462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
| 3300012971|Ga0126369_11508808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300015053|Ga0137405_1141775 | Not Available | 1745 | Open in IMG/M |
| 3300016319|Ga0182033_10936919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300016319|Ga0182033_11207980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300016341|Ga0182035_11180667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300016387|Ga0182040_10775330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
| 3300016445|Ga0182038_11169963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300017973|Ga0187780_10759330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300017975|Ga0187782_10957796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300020580|Ga0210403_10855529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300021441|Ga0213871_10038721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1274 | Open in IMG/M |
| 3300021560|Ga0126371_11985356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300022563|Ga0212128_10831581 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300026328|Ga0209802_1256093 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300026358|Ga0257166_1005404 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300026550|Ga0209474_10039078 | All Organisms → cellular organisms → Bacteria | 3485 | Open in IMG/M |
| 3300027681|Ga0208991_1140680 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027842|Ga0209580_10147371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1157 | Open in IMG/M |
| 3300027855|Ga0209693_10143366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| 3300027907|Ga0207428_10934180 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031236|Ga0302324_101853428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300031236|Ga0302324_103326734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300031241|Ga0265325_10390159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300031545|Ga0318541_10260743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 964 | Open in IMG/M |
| 3300031546|Ga0318538_10600662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300031561|Ga0318528_10078978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1704 | Open in IMG/M |
| 3300031573|Ga0310915_10704536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300031573|Ga0310915_11114592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031720|Ga0307469_11579777 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031723|Ga0318493_10562868 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300031744|Ga0306918_10259496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1329 | Open in IMG/M |
| 3300031765|Ga0318554_10821657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300031770|Ga0318521_10112920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1510 | Open in IMG/M |
| 3300031792|Ga0318529_10407866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300031805|Ga0318497_10270703 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300031846|Ga0318512_10633152 | Not Available | 546 | Open in IMG/M |
| 3300031897|Ga0318520_10243639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1071 | Open in IMG/M |
| 3300031910|Ga0306923_10668417 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300031942|Ga0310916_10328247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1298 | Open in IMG/M |
| 3300031945|Ga0310913_10495830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 867 | Open in IMG/M |
| 3300031945|Ga0310913_10532789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300031947|Ga0310909_10772563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300031954|Ga0306926_10318481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1924 | Open in IMG/M |
| 3300031954|Ga0306926_12968522 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031962|Ga0307479_10788727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
| 3300032035|Ga0310911_10297432 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300032054|Ga0318570_10090715 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300032065|Ga0318513_10130685 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300032068|Ga0318553_10766066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300032076|Ga0306924_10987841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300032089|Ga0318525_10207930 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300032091|Ga0318577_10537853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300032091|Ga0318577_10565460 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300032094|Ga0318540_10447862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300032094|Ga0318540_10650780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300033290|Ga0318519_10952478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.64% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000561 | Amended soil microbial communities from Kansas Great Prairies, USA - acetate DNA F2.1B clc assemly | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F21B_106940091 | 3300000561 | Soil | RFHSPEGVGLMTATPKPTEHLTVDVEDPRTLTAPQLSKTIEEKWR* |
| F14TB_1002365301 | 3300001431 | Soil | VSLMTATPKPTEHLTVDVEDPRSLTKSQLSGNVEEKWR* |
| Ga0063356_1055206921 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GVCLMTATPKPTEHLTVDVEDPRTLTETQRTGATEQKWR* |
| Ga0066676_105850532 | 3300005186 | Soil | HAPEGVTVVTATPKPTEHLTVDVEDPRTLTAAQRSNAVEEKWR* |
| Ga0066388_1026020161 | 3300005332 | Tropical Forest Soil | GVSLMTATPKPTEHLTVDVEDPRTLTAAQRSSTIEEKWR* |
| Ga0070713_1019436211 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | APNGVSIVTATPRPTEHLTVDVEDPRRLSDAERAANSEEKVR* |
| Ga0070706_1019355152 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SPEGVSLVTATPKPTEHLTVDVEDPRTLTSAQLSNTIEEKWR* |
| Ga0070741_109807321 | 3300005529 | Surface Soil | APNGVSIVTATPRPTEHLTVDVADPRTLSDAERAANSEEKVR* |
| Ga0066661_105622791 | 3300005554 | Soil | VTVVTATPKPTEHLTVDVEDPRTLTAAQLSNAVEEKWR* |
| Ga0068856_1026007601 | 3300005614 | Corn Rhizosphere | SIVTATPRPTEHLTVDVADPRTLSDAERASNSEAKTH* |
| Ga0066905_1020649261 | 3300005713 | Tropical Forest Soil | PEGVSLMTATPKPTEHLTVDVDDPRTLTQSQLSGNVEEKWR* |
| Ga0066903_1016191631 | 3300005764 | Tropical Forest Soil | VTLMTATPKPTEHLTVDVDDPRTLTAAQRSNTTEEKWR* |
| Ga0066903_1021986361 | 3300005764 | Tropical Forest Soil | PEGVSLMTATPKPTEHLTVDVEDPRTLTKSQLSSNTEEKWR* |
| Ga0066903_1022571053 | 3300005764 | Tropical Forest Soil | EGVSLMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR* |
| Ga0066903_1026958101 | 3300005764 | Tropical Forest Soil | VTATPRPTEHLTIDVEDPRTLSDTERSANSEEKVR* |
| Ga0066903_1056036981 | 3300005764 | Tropical Forest Soil | MTATPKPTEHLTVDVEDPRTLTATELPRNIEGKWR* |
| Ga0066903_1059257782 | 3300005764 | Tropical Forest Soil | FHSPEGVSVMTATPKPTEHLTVDVEDPRTLTRSQLSGNVEEKWR* |
| Ga0075283_11035951 | 3300005891 | Rice Paddy Soil | APNGVSIVTVTPRPTEHLTVDVEDPRTLSDDERAANSEAKVR* |
| Ga0066696_100949903 | 3300006032 | Soil | TWHRFHAPEGVSLLTATPKPTEHLTVDVEDPRTLTAAKLSNTIEEKWR* |
| Ga0066656_106805781 | 3300006034 | Soil | LTATPKPTEHLTVDVEDPRTLTAAQLPDAIEEKWR* |
| Ga0066660_101710081 | 3300006800 | Soil | RFHAPEGVSLLTATPKPTEHLTVDVEDPRTLTAAKLSNTIEEKWR* |
| Ga0075420_1012389463 | 3300006853 | Populus Rhizosphere | TATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR* |
| Ga0099794_106601591 | 3300007265 | Vadose Zone Soil | LMTATPKPTEHLTVDVEDPRTLTAAQKSDATEEKWR* |
| Ga0099829_105980202 | 3300009038 | Vadose Zone Soil | NGVSLVTATPKPTEHLTVDIEDPRTLTSAQLSDTIEEKWR* |
| Ga0099828_120141801 | 3300009089 | Vadose Zone Soil | VCLITATPKPTEHLTVTVEDPRTLTAAQQSGATEEKWR* |
| Ga0099827_113023902 | 3300009090 | Vadose Zone Soil | APDGVCLMTATPKPTEHLTVDVEDPRTLSAEQQSGATEEQWR* |
| Ga0075418_118396273 | 3300009100 | Populus Rhizosphere | GLMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR* |
| Ga0075423_120448192 | 3300009162 | Populus Rhizosphere | MTATPKPTEHLTVDVEDPRTLTVAQLSNTIEEKWR* |
| Ga0114945_101286271 | 3300009444 | Thermal Springs | LMTATPKPTEHLTVDVGDPRSLSAGQLSGSTEEKWR* |
| Ga0126384_118195021 | 3300010046 | Tropical Forest Soil | PDGVSVVTATPKPTEHLTVDVEDPRTLTTVQLSNTIEEKWR* |
| Ga0126382_103655511 | 3300010047 | Tropical Forest Soil | QGVSLMTATPKPTEHLTVDVEDPRTLTKSQLSSNTEEKWR* |
| Ga0134063_106199562 | 3300010335 | Grasslands Soil | MTVPGVSLMTATPKPTEHLTVDIEDPRTLTDAQRAGNTEEKWR* |
| Ga0074044_104145562 | 3300010343 | Bog Forest Soil | VGIVTATPRPTEHLTIDVEDPRTLSDAQRAANSEEKVR* |
| Ga0126370_123812663 | 3300010358 | Tropical Forest Soil | GVSLVTATPKPTEHLTVDVEDPRTLSGAHLSGNIEEKWR* |
| Ga0126376_102899173 | 3300010359 | Tropical Forest Soil | VTATPKPTEHLTVDVADPGTLSGAERSSHTEEKWR* |
| Ga0126372_108376071 | 3300010360 | Tropical Forest Soil | GVSLMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR* |
| Ga0126372_111578911 | 3300010360 | Tropical Forest Soil | HSPEGVSLMTATPKPTEHLTVDVDDPRTLTKTQLSNNTEEKWR* |
| Ga0126378_121558221 | 3300010361 | Tropical Forest Soil | GVTLMTATPKPTEHLTVDIADPRALDAAKLSGNVEAKWR* |
| Ga0126377_124607863 | 3300010362 | Tropical Forest Soil | LMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR* |
| Ga0126377_126265042 | 3300010362 | Tropical Forest Soil | LVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWA* |
| Ga0126379_135372181 | 3300010366 | Tropical Forest Soil | HSPEGVSLMTATPKPTEHLTVDVDDPRTLTKSQLSGNTEEKWR* |
| Ga0126381_1043431422 | 3300010376 | Tropical Forest Soil | VSLVTATPKPTEHLTADVEDPRTLTAAQLSGNIEEKWR* |
| Ga0126383_110797332 | 3300010398 | Tropical Forest Soil | VTATPKPTEHLTVDVDDPRALTAAQLSNTIEEEWR* |
| Ga0126383_132590241 | 3300010398 | Tropical Forest Soil | PEGVTLITATPKPTEHLTVDVDDPQALTAAQLSNTIEEKWR* |
| Ga0137383_109318011 | 3300012199 | Vadose Zone Soil | LMTATPKPTEHLTADVEDPRTLTAAQQSGATEEKWR* |
| Ga0150985_1021515482 | 3300012212 | Avena Fatua Rhizosphere | FESPEGVCLMTATPKPTEHLTVNVADPRTLEAERLQGSVEEKWR* |
| Ga0137360_105921681 | 3300012361 | Vadose Zone Soil | GGVSLMTATPKPTEHLTVDVEDPRTLTAAQLSNTIEEKWR* |
| Ga0137361_111725602 | 3300012362 | Vadose Zone Soil | MTATPKPTEHLTVEVEDPRTLTAAQKSDATEEKWR* |
| Ga0150984_1094403011 | 3300012469 | Avena Fatua Rhizosphere | GVSLITATPKPTEHLTVDVADPRTLTDTEHSEEKWR* |
| Ga0137373_104171143 | 3300012532 | Vadose Zone Soil | VSLLTATPKPTEHLTVDVEDPRSLTAAQLPNSIEEKWR* |
| Ga0137419_104756091 | 3300012925 | Vadose Zone Soil | RFHAPEGVTVVTATPKPTEHLTVDVEDPRTLTAAQRSNAVEEKWR* |
| Ga0137419_113806551 | 3300012925 | Vadose Zone Soil | MTATPKPTEHLTVDVEDPRTLSAAQQSGATEEKWR* |
| Ga0137404_119867011 | 3300012929 | Vadose Zone Soil | PDGVCLMTATPKPTEHLTVDVEDPRTLTAAQKSDATEEKWR* |
| Ga0126369_105764621 | 3300012971 | Tropical Forest Soil | HAPNGVSIITATPRPTEHLTVDVEDPRTLSDAERAANSEEKIH* |
| Ga0126369_115088082 | 3300012971 | Tropical Forest Soil | LVTATPKPTEHLTVDVEDPRSLEGVQLSGSIEEKWR* |
| Ga0137405_11417754 | 3300015053 | Vadose Zone Soil | FHSPGGVSLMTATPKPTEHLTVDVEDPRTLTAAQLSNTIEEKWR* |
| Ga0182033_109369191 | 3300016319 | Soil | VIGVTLITVTPKPTEHLMVDVEDPRVLTPAELSGTIEEKWR |
| Ga0182033_112079802 | 3300016319 | Soil | FKSADGVTLITATPKSTEHLTVDVADPRTLTAAQLSGNTEEKWR |
| Ga0182035_111806672 | 3300016341 | Soil | TLITATPKPTEHLTVDVEDPRTLSAAQRAGNTEEKWR |
| Ga0182040_107753302 | 3300016387 | Soil | VSLVTATPKPTEHLTVDVEDPRTLKGAQLSGNVEEKWR |
| Ga0182038_111699632 | 3300016445 | Soil | APNGVSVVTATPRPTEHLTVDVEDPRTLSDAERAANSEEKVR |
| Ga0187780_107593302 | 3300017973 | Tropical Peatland | NGVSIVTATPRPTEHLTVDVEDPRTLSDVERAGNSEEKWR |
| Ga0187782_109577961 | 3300017975 | Tropical Peatland | VMTATPKPTEHLTVDVADPRTLTAEQLSGNVEEKWR |
| Ga0210403_108555292 | 3300020580 | Soil | FHAPNGVSIVTATPRPTEHLTVNVEDPRTLSNAERAANSEEKVR |
| Ga0213871_100387211 | 3300021441 | Rhizosphere | PDGVALMTATPKPTEHLTVDVADPRTLTRTQLPRNIEEKWR |
| Ga0126371_119853561 | 3300021560 | Tropical Forest Soil | DGVGLMTATPKPTEHLTVDVADPRALDEAQLPGNIEQKWR |
| Ga0212128_108315812 | 3300022563 | Thermal Springs | LMTATPKPTEHLTVDVGDPRSLSAGQLSGSTEEKWR |
| Ga0209802_12560932 | 3300026328 | Soil | PGGVSLMTATPKPTEHLTVDVEDPRTLTTAQLSNTIEEKWR |
| Ga0257166_10054042 | 3300026358 | Soil | MTATPKPTEHLTVDVEDPRTLTAAQLSNTIEEKWR |
| Ga0209474_100390784 | 3300026550 | Soil | LLTATPKPTEHLTVDVEDPRTLTAAKLSNTIEEKWR |
| Ga0208991_11406802 | 3300027681 | Forest Soil | LVTATPKPTEHLTVDVDDPRTLTAAQLSNTIEEKWR |
| Ga0209580_101473711 | 3300027842 | Surface Soil | SADGVCLMTATPKPTEHLTVDVADPRTLSEAQRGGNTEEKWR |
| Ga0209693_101433661 | 3300027855 | Soil | HAPEGVSIVTATPRPTEHLTVDVDDPRTLTEAQRTGNTEEKWG |
| Ga0207428_109341802 | 3300027907 | Populus Rhizosphere | TWHRFHSPDGVSLVTATPKPTEHLTVDVEDPRQLTSAELSGNTEEKWR |
| Ga0302324_1018534282 | 3300031236 | Palsa | FHAPDGVSIITATPRPTEHLTVDVEDPRVLSDAERAANSEEKVR |
| Ga0302324_1033267341 | 3300031236 | Palsa | FSAPNGVSIVTATPRPTEHLTVDVEDPRVLSDGERAANSEEKVR |
| Ga0265325_103901592 | 3300031241 | Rhizosphere | NTWHRFHAPNGVGIVTATPRPTEHLTVDVADPRTLSDMERAANSEEKVR |
| Ga0318541_102607433 | 3300031545 | Soil | PDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR |
| Ga0318538_106006622 | 3300031546 | Soil | RFHAPNGVSVVTATLRPTEHLTVDVEDPRTLSDAERAANSEEKVR |
| Ga0318528_100789781 | 3300031561 | Soil | VSLMTATPKPTEHLTVDVADPRALDAAQLPGNIEEKWR |
| Ga0310915_107045362 | 3300031573 | Soil | MTATPKPTEHLTVDVADPRTLDAAQLSGNTEAKWR |
| Ga0310915_111145921 | 3300031573 | Soil | NGVSIVTATPRPTEHLTVDVEDPRTLTDNERSAHSEEKVR |
| Ga0307469_115797772 | 3300031720 | Hardwood Forest Soil | SLLTATPKPTEHLTVDVDDPRTLTSAQRSSATEEKWR |
| Ga0318493_105628682 | 3300031723 | Soil | TWHRFHSPEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWV |
| Ga0306918_102594961 | 3300031744 | Soil | ESPDGVSLMTATPKPTEHLTVDVADPRALDAAQLPGNIEEKWR |
| Ga0318554_108216571 | 3300031765 | Soil | HRFRAPIGVSIVTATPRPTEHLTIDVEDPRTLSDAERGANSEQKVR |
| Ga0318521_101129202 | 3300031770 | Soil | TGVTVMTATPKPTEHLTVDVEDPRTLTATQLSGTIEEKWR |
| Ga0318529_104078661 | 3300031792 | Soil | LVTAAPKPTEHLTVGVEDPRTLTDGQRAAATEHKWR |
| Ga0318497_102707031 | 3300031805 | Soil | SPEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWA |
| Ga0318512_106331521 | 3300031846 | Soil | VVVVPQNMWHRFYAPEGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR |
| Ga0318520_102436392 | 3300031897 | Soil | TWHRFRAPIGVSIVTATPRPTEHLTIDVEDPRTLSDAERGANSEQKVR |
| Ga0306923_106684173 | 3300031910 | Soil | MWHRFYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR |
| Ga0310916_103282472 | 3300031942 | Soil | FESVNGVTLITATPKPTEHLTVDVEDPRTLTAAELSGTIEEKWR |
| Ga0310913_104958301 | 3300031945 | Soil | ITATPKPTEHLTVDVEDPRTLTAAELSGTIEEKWR |
| Ga0310913_105327892 | 3300031945 | Soil | APNGVSVVTATPRPTEHLTVDVEDPRTLSEAERAANSEEKVR |
| Ga0310909_107725631 | 3300031947 | Soil | GVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR |
| Ga0306926_103184811 | 3300031954 | Soil | IAAAPYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR |
| Ga0306926_129685221 | 3300031954 | Soil | MWHRFYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHK |
| Ga0307479_107887272 | 3300031962 | Hardwood Forest Soil | LITATPKPTEHLTVDVEDPRTLSDPQRSGNTEEKWR |
| Ga0310911_102974324 | 3300032035 | Soil | MWHRFYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRGAATEHKWR |
| Ga0318570_100907151 | 3300032054 | Soil | PEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWV |
| Ga0318513_101306853 | 3300032065 | Soil | VTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWV |
| Ga0318553_107660661 | 3300032068 | Soil | HRFHAPRGVSIVTATPRPTEHLTIDVEDPRTLSDAERAANSEEKLR |
| Ga0306924_109878411 | 3300032076 | Soil | QNMWHRFYAPDGVTLVTATPKPTEHLTVGVEDPRTLTDAQRAAATEHKWR |
| Ga0318525_102079303 | 3300032089 | Soil | TWHRFRSPEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWA |
| Ga0318577_105378532 | 3300032091 | Soil | VDGVTLITVTPKPTEHLMVDVEDPRVLTPAELSGTIEEKWR |
| Ga0318577_105654601 | 3300032091 | Soil | SPEGVSLVTATPKPTEHLTVDVEDPRVLTAAQLSDTVEKKWV |
| Ga0318540_104478622 | 3300032094 | Soil | DGVTLITVTPKPTEHLMVDVEDPRVLTPAELSGTIEEKWR |
| Ga0318540_106507801 | 3300032094 | Soil | FHAPRGVSIVTATPRPTEHLTIDVEDPRTLSDAERAANSEEKLR |
| Ga0318519_109524781 | 3300033290 | Soil | HAPRGVSIVTATPRPTEHLTIDVEDPRTLSDAERAANSEEKLR |
| ⦗Top⦘ |