


| Basic Information | |
|---|---|
| Family ID | F087874 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMS |
| Number of Associated Samples | 31 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.39 % |
| % of genes near scaffold ends (potentially truncated) | 95.45 % |
| % of genes from short scaffolds (< 2000 bps) | 79.09 % |
| Associated GOLD sequencing projects | 24 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.091 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut (98.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut (100.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 52.38% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13414 | TPR_11 | 0.91 |
| PF00483 | NTP_transferase | 0.91 |
| PF00075 | RNase_H | 0.91 |
| PF16087 | DUF4817 | 0.91 |
| PF02666 | PS_Dcarbxylase | 0.91 |
| PF13358 | DDE_3 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.09 % |
| All Organisms | root | All Organisms | 30.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001468|JGI20162J15292_1001045 | Not Available | 1311 | Open in IMG/M |
| 3300001544|JGI20163J15578_10166918 | Not Available | 1402 | Open in IMG/M |
| 3300001544|JGI20163J15578_10170227 | Not Available | 1389 | Open in IMG/M |
| 3300001544|JGI20163J15578_10526467 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea | 733 | Open in IMG/M |
| 3300001544|JGI20163J15578_10632130 | Not Available | 645 | Open in IMG/M |
| 3300001544|JGI20163J15578_10828131 | Not Available | 525 | Open in IMG/M |
| 3300002125|JGI20165J26630_10108017 | Not Available | 1169 | Open in IMG/M |
| 3300002125|JGI20165J26630_10435981 | Not Available | 676 | Open in IMG/M |
| 3300002125|JGI20165J26630_10535413 | Not Available | 615 | Open in IMG/M |
| 3300002125|JGI20165J26630_10568029 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera | 599 | Open in IMG/M |
| 3300002127|JGI20164J26629_10033739 | Not Available | 1563 | Open in IMG/M |
| 3300002127|JGI20164J26629_10169563 | Not Available | 829 | Open in IMG/M |
| 3300002127|JGI20164J26629_10330156 | Not Available | 644 | Open in IMG/M |
| 3300002127|JGI20164J26629_10603006 | Not Available | 502 | Open in IMG/M |
| 3300002175|JGI20166J26741_11509674 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea | 1509 | Open in IMG/M |
| 3300002175|JGI20166J26741_11539641 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora | 4961 | Open in IMG/M |
| 3300002175|JGI20166J26741_11540499 | Not Available | 1423 | Open in IMG/M |
| 3300002175|JGI20166J26741_11542820 | Not Available | 1417 | Open in IMG/M |
| 3300002175|JGI20166J26741_11622404 | Not Available | 1237 | Open in IMG/M |
| 3300002175|JGI20166J26741_11846134 | Not Available | 910 | Open in IMG/M |
| 3300002175|JGI20166J26741_11999772 | Not Available | 763 | Open in IMG/M |
| 3300002185|JGI20163J26743_10749697 | Not Available | 663 | Open in IMG/M |
| 3300002185|JGI20163J26743_11013544 | Not Available | 837 | Open in IMG/M |
| 3300002185|JGI20163J26743_11094630 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera | 912 | Open in IMG/M |
| 3300002185|JGI20163J26743_11279549 | Not Available | 1176 | Open in IMG/M |
| 3300002185|JGI20163J26743_11283230 | Not Available | 1184 | Open in IMG/M |
| 3300002185|JGI20163J26743_11520474 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 3071 | Open in IMG/M |
| 3300002238|JGI20169J29049_10895949 | Not Available | 749 | Open in IMG/M |
| 3300002238|JGI20169J29049_11227162 | Not Available | 1204 | Open in IMG/M |
| 3300002308|JGI20171J29575_12210879 | Not Available | 898 | Open in IMG/M |
| 3300002462|JGI24702J35022_10482433 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota | 758 | Open in IMG/M |
| 3300002462|JGI24702J35022_10605967 | Not Available | 678 | Open in IMG/M |
| 3300002501|JGI24703J35330_10717615 | Not Available | 503 | Open in IMG/M |
| 3300002501|JGI24703J35330_10971734 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus | 616 | Open in IMG/M |
| 3300002501|JGI24703J35330_11058655 | Not Available | 665 | Open in IMG/M |
| 3300002501|JGI24703J35330_11250033 | Not Available | 802 | Open in IMG/M |
| 3300002501|JGI24703J35330_11293516 | Not Available | 842 | Open in IMG/M |
| 3300002501|JGI24703J35330_11414977 | Not Available | 980 | Open in IMG/M |
| 3300002501|JGI24703J35330_11494264 | Not Available | 1105 | Open in IMG/M |
| 3300002501|JGI24703J35330_11531129 | Not Available | 1180 | Open in IMG/M |
| 3300002501|JGI24703J35330_11534441 | Not Available | 1187 | Open in IMG/M |
| 3300002501|JGI24703J35330_11740219 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 3381 | Open in IMG/M |
| 3300002504|JGI24705J35276_11506859 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 559 | Open in IMG/M |
| 3300002504|JGI24705J35276_11518782 | Not Available | 563 | Open in IMG/M |
| 3300002504|JGI24705J35276_11916598 | Not Available | 764 | Open in IMG/M |
| 3300002508|JGI24700J35501_10903594 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea | 3151 | Open in IMG/M |
| 3300002509|JGI24699J35502_10271587 | Not Available | 508 | Open in IMG/M |
| 3300002509|JGI24699J35502_10656263 | Not Available | 726 | Open in IMG/M |
| 3300002552|JGI24694J35173_10754506 | Not Available | 550 | Open in IMG/M |
| 3300002834|JGI24696J40584_12241619 | Not Available | 501 | Open in IMG/M |
| 3300006045|Ga0082212_10135964 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 2379 | Open in IMG/M |
| 3300006045|Ga0082212_10218450 | Not Available | 1781 | Open in IMG/M |
| 3300006045|Ga0082212_10227184 | Not Available | 1739 | Open in IMG/M |
| 3300006045|Ga0082212_10280984 | Not Available | 1530 | Open in IMG/M |
| 3300006045|Ga0082212_10390919 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 1254 | Open in IMG/M |
| 3300006045|Ga0082212_10395848 | Not Available | 1245 | Open in IMG/M |
| 3300006045|Ga0082212_10415014 | Not Available | 1210 | Open in IMG/M |
| 3300006045|Ga0082212_10463502 | Not Available | 1133 | Open in IMG/M |
| 3300006045|Ga0082212_10578257 | Not Available | 989 | Open in IMG/M |
| 3300006045|Ga0082212_10586524 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 980 | Open in IMG/M |
| 3300006045|Ga0082212_10620019 | Not Available | 946 | Open in IMG/M |
| 3300009784|Ga0123357_10114065 | All Organisms → cellular organisms → Eukaryota | 3432 | Open in IMG/M |
| 3300009784|Ga0123357_10127699 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 3179 | Open in IMG/M |
| 3300009784|Ga0123357_10131136 | Not Available | 3120 | Open in IMG/M |
| 3300009784|Ga0123357_10707644 | Not Available | 719 | Open in IMG/M |
| 3300009784|Ga0123357_10862636 | Not Available | 595 | Open in IMG/M |
| 3300009826|Ga0123355_10067684 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 5746 | Open in IMG/M |
| 3300009826|Ga0123355_10156496 | All Organisms → cellular organisms → Eukaryota | 3446 | Open in IMG/M |
| 3300009826|Ga0123355_11848220 | Not Available | 567 | Open in IMG/M |
| 3300010049|Ga0123356_10853145 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
| 3300010162|Ga0131853_10007814 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 19402 | Open in IMG/M |
| 3300010162|Ga0131853_10034319 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota | 8982 | Open in IMG/M |
| 3300010162|Ga0131853_10087209 | Not Available | 4776 | Open in IMG/M |
| 3300010167|Ga0123353_10231908 | Not Available | 2877 | Open in IMG/M |
| 3300027558|Ga0209531_10221731 | Not Available | 634 | Open in IMG/M |
| 3300027558|Ga0209531_10247034 | Not Available | 602 | Open in IMG/M |
| 3300027670|Ga0209423_10192521 | Not Available | 984 | Open in IMG/M |
| 3300027864|Ga0209755_10040624 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 4723 | Open in IMG/M |
| 3300027864|Ga0209755_10154109 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus | 2319 | Open in IMG/M |
| 3300027864|Ga0209755_10214107 | Not Available | 1920 | Open in IMG/M |
| 3300027864|Ga0209755_10566421 | Not Available | 1001 | Open in IMG/M |
| 3300027864|Ga0209755_10664966 | Not Available | 886 | Open in IMG/M |
| 3300027864|Ga0209755_10693025 | Not Available | 857 | Open in IMG/M |
| 3300027864|Ga0209755_10693685 | Not Available | 856 | Open in IMG/M |
| 3300027864|Ga0209755_10921573 | Not Available | 670 | Open in IMG/M |
| 3300027864|Ga0209755_11155193 | Not Available | 540 | Open in IMG/M |
| 3300027864|Ga0209755_11235354 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 505 | Open in IMG/M |
| 3300027891|Ga0209628_10181978 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda | 2214 | Open in IMG/M |
| 3300027891|Ga0209628_10317367 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema | 1638 | Open in IMG/M |
| 3300027891|Ga0209628_10393333 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1434 | Open in IMG/M |
| 3300027904|Ga0209737_10242058 | Not Available | 1866 | Open in IMG/M |
| 3300027904|Ga0209737_10357566 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus | 1520 | Open in IMG/M |
| 3300027904|Ga0209737_10907948 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera | 859 | Open in IMG/M |
| 3300027960|Ga0209627_1238150 | Not Available | 589 | Open in IMG/M |
| 3300027966|Ga0209738_10057136 | Not Available | 1572 | Open in IMG/M |
| 3300027966|Ga0209738_10141032 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 1137 | Open in IMG/M |
| 3300027966|Ga0209738_10224535 | Not Available | 943 | Open in IMG/M |
| 3300027966|Ga0209738_10361514 | Not Available | 743 | Open in IMG/M |
| 3300027984|Ga0209629_10041145 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Termopsidae → Termopsinae → Termopsini → Zootermopsis → Zootermopsis nevadensis | 4415 | Open in IMG/M |
| 3300027984|Ga0209629_10156787 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 2304 | Open in IMG/M |
| 3300027984|Ga0209629_10516871 | Not Available | 1034 | Open in IMG/M |
| 3300028325|Ga0268261_10048564 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 3598 | Open in IMG/M |
| 3300028325|Ga0268261_10337244 | Not Available | 1316 | Open in IMG/M |
| 3300028325|Ga0268261_10420519 | Not Available | 1118 | Open in IMG/M |
| 3300028325|Ga0268261_10496741 | Not Available | 975 | Open in IMG/M |
| 3300028325|Ga0268261_10753188 | Not Available | 570 | Open in IMG/M |
| 3300028325|Ga0268261_10756234 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 565 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 98.18% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Proctodeal Segment → Termite Gut | 1.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001468 | Cubitermes ugandensis midgut segment microbial communities from Kakamega Forest, Kenya - Cu122M | Host-Associated | Open in IMG/M |
| 3300001544 | Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1 | Host-Associated | Open in IMG/M |
| 3300002125 | Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4 | Host-Associated | Open in IMG/M |
| 3300002127 | Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 | Host-Associated | Open in IMG/M |
| 3300002175 | Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 | Host-Associated | Open in IMG/M |
| 3300002185 | Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1 | Host-Associated | Open in IMG/M |
| 3300002238 | Nasutitermes corniger P1 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P1 | Host-Associated | Open in IMG/M |
| 3300002308 | Nasutitermes corniger P4 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P4 | Host-Associated | Open in IMG/M |
| 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Host-Associated | Open in IMG/M |
| 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Host-Associated | Open in IMG/M |
| 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Host-Associated | Open in IMG/M |
| 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Host-Associated | Open in IMG/M |
| 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Host-Associated | Open in IMG/M |
| 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Host-Associated | Open in IMG/M |
| 3300002552 | Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1 | Host-Associated | Open in IMG/M |
| 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Host-Associated | Open in IMG/M |
| 3300006045 | Neocapritermes taracua P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P3 | Host-Associated | Open in IMG/M |
| 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Host-Associated | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Host-Associated | Open in IMG/M |
| 3300027558 | Cubitermes ugandensis crop segment gut microbial communities from Kakamega Forest, Kenya - Cu122C (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027670 | Nasutitermes corniger crop gut microbial community from laboratory colony in Florida, USA - Nc150C (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027864 | Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027891 | Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027904 | Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027960 | Cubitermes ugandensis midgut segment microbial communities from Kakamega Forest, Kenya - Cu122M (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027966 | Nasutitermes corniger P5 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027984 | Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028325 | Nasutitermes corniger P1 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P1 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20162J15292_10010451 | 3300001468 | Termite Gut | MHAQCVLVATTLLHSSAKFHSFLYTGSKTVLVNMESCYGGMSTRLKQ |
| JGI20163J15578_101669184 | 3300001544 | Termite Gut | MRAQCVLVATTLLHSSAKFNSFLYTGSKTVRVNMESCYGGMS |
| JGI20163J15578_101702272 | 3300001544 | Termite Gut | MHAQCVLVATTLLHSSAKFHSFLYTGSKTVLVNMESCYGGMSTRLK |
| JGI20163J15578_105264671 | 3300001544 | Termite Gut | MHTQCVLVVTTLLHSGAKFHSFLYTGSKTVRVNME |
| JGI20163J15578_106321301 | 3300001544 | Termite Gut | MRAQCVLIATTLLHSGAKFHSFLYTGSKTVRVNMESCYG |
| JGI20163J15578_108281311 | 3300001544 | Termite Gut | MHTQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMGL |
| JGI20165J26630_101080174 | 3300002125 | Termite Gut | MRAQCVLVATTVLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTR |
| JGI20165J26630_104359811 | 3300002125 | Termite Gut | MRAQCVLIATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGM |
| JGI20165J26630_105354131 | 3300002125 | Termite Gut | MRAQCVLVATTLQHSSAKFHSFLYTGSKTVRVNMESCYGGM |
| JGI20165J26630_105680292 | 3300002125 | Termite Gut | MHAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCYGGMSTR |
| JGI20165J26630_106661222 | 3300002125 | Termite Gut | MRAHCVLVATTLLHSSAKFHSFLYTGSKTVRVNVE |
| JGI20164J26629_100337391 | 3300002127 | Termite Gut | MHAQCVLVATTLLHSSAKFHSFLYTGSKTVLVNMES |
| JGI20164J26629_101695631 | 3300002127 | Termite Gut | MCAQCVLVATTLLHSGAKFNSFLYTGSKTVRVNMESCYGGM |
| JGI20164J26629_103301561 | 3300002127 | Termite Gut | MRAQCVLVATTLLHXXAKFXSFLYTXSKTVRVNMESCYGGMS |
| JGI20164J26629_105157041 | 3300002127 | Termite Gut | LVATTLLHSSAKFHSFLYTGSKTVRVNVESCYGGM* |
| JGI20164J26629_106030061 | 3300002127 | Termite Gut | MRAQRVLVATALLHSGAKFHSFLYTGSKTVRVNMESCYGGM |
| JGI20166J26741_115096741 | 3300002175 | Termite Gut | MCAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCYGGMS |
| JGI20166J26741_1153964110 | 3300002175 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMES |
| JGI20166J26741_115404991 | 3300002175 | Termite Gut | MRAQCVLVATTLLHSSAKFNSFLYTGSKTVRVNMES |
| JGI20166J26741_115428201 | 3300002175 | Termite Gut | MRAQCILVATTLLHSSAKFHSFLYTGSKTVRVNMESCY |
| JGI20166J26741_116224041 | 3300002175 | Termite Gut | MRAQCVLVATTLQHSSAKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| JGI20166J26741_118461343 | 3300002175 | Termite Gut | MRAQCVLIATTLLHSGAKFHSFLYTGSKTVRVNMESC |
| JGI20166J26741_119997722 | 3300002175 | Termite Gut | MRAQCVLVATALLHSGAKFHSFLYTGSKTVRVNMESCYGGMST |
| JGI20163J26743_107496972 | 3300002185 | Termite Gut | MRAQCILVATTLLHSSAKFHSFLYTGSKTVRVNMESCYG |
| JGI20163J26743_110135442 | 3300002185 | Termite Gut | MRAQRVLVATALLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTR |
| JGI20163J26743_110946301 | 3300002185 | Termite Gut | MHAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMES |
| JGI20163J26743_112795491 | 3300002185 | Termite Gut | MRAQCVLVATTVLHSGAKFHSFLYTGSKTVRVNMESCYGGMS |
| JGI20163J26743_112832303 | 3300002185 | Termite Gut | MRTQCVLVATTLLHSGAKFHSFLYTGSKTVLVNMES |
| JGI20163J26743_115204741 | 3300002185 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCYG |
| JGI20169J29049_108959491 | 3300002238 | Termite Gut | MRAQFVLVATTLLHSGAKFHSFLYTGSKTVRVNMESC |
| JGI20169J29049_112271621 | 3300002238 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCYGGMSTRLKQ |
| JGI20171J29575_122108791 | 3300002308 | Termite Gut | MRAQCVLVATTLLHSSVKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| JGI24702J35022_104824332 | 3300002462 | Termite Gut | MRAGVLVATILLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLKQR |
| JGI24702J35022_106059671 | 3300002462 | Termite Gut | MRAQCVLVATTLMHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| JGI24703J35330_107176151 | 3300002501 | Termite Gut | MRAQCVLVATTLLHRGAKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| JGI24703J35330_109717341 | 3300002501 | Termite Gut | MRAQCVLVSKNLLHSGAKFHSFLYTGSKTVRVNMESCYGGMS |
| JGI24703J35330_110586552 | 3300002501 | Termite Gut | MRAQCVLVVTTLLHSCAKFHSFLYTGSKTVRVNMESCYGGM |
| JGI24703J35330_112500332 | 3300002501 | Termite Gut | MLAQCVLVATALLHSGAKFHSFLYTGSKTVRVNMESCYGGMS |
| JGI24703J35330_112935162 | 3300002501 | Termite Gut | MRAQSVLVAKTLLHSGAKFHSFLYTGSKTVRVNMESCYGSMSTRLKQRA |
| JGI24703J35330_114149771 | 3300002501 | Termite Gut | MRAQCVLVVTTLLHSSAKFHSFLYTGSKTVRVNMESCYGGM |
| JGI24703J35330_114942641 | 3300002501 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| JGI24703J35330_115311291 | 3300002501 | Termite Gut | MRAQCVLVATTVLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| JGI24703J35330_115344411 | 3300002501 | Termite Gut | MRAQYVLVSTTLLHSGAKFHSFLYTGSKTVRVNMESCYGG |
| JGI24703J35330_117402192 | 3300002501 | Termite Gut | MRAQCVLVVTTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTR |
| JGI24705J35276_115068591 | 3300002504 | Termite Gut | MRTQCVLVATTLLHSGGKFHSFLYTGSKTVRVNMESCYGGMSTILNNVR* |
| JGI24705J35276_115187822 | 3300002504 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCYGGMST |
| JGI24705J35276_119165981 | 3300002504 | Termite Gut | MRAQSVLVAKTLLHSGAKFHSFLYTGSKTVRVNMESCYGSMSTRLK |
| JGI24697J35500_105653671 | 3300002507 | Termite Gut | MHTVKYFATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGM |
| JGI24700J35501_109035941 | 3300002508 | Termite Gut | MRAQCVLVATTLMHSGAKFHSFLYTGSKTVRVNMESCYGGMSTR |
| JGI24699J35502_102715871 | 3300002509 | Termite Gut | MREQCVLVATTLLHRGAKFHSFLYTGSKTVRVNMESCYGGMSTRLKQ |
| JGI24699J35502_106562633 | 3300002509 | Termite Gut | MREQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGM |
| JGI24694J35173_107545061 | 3300002552 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMS |
| JGI24696J40584_122416191 | 3300002834 | Termite Gut | MRAHCVHVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRL |
| Ga0082212_101359641 | 3300006045 | Termite Gut | MHAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNME |
| Ga0082212_102184505 | 3300006045 | Termite Gut | MRTQCVVVATTLLHSGAKFHSFLYTGSKTVRVNME |
| Ga0082212_102271843 | 3300006045 | Termite Gut | MSTQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTKL |
| Ga0082212_102809841 | 3300006045 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCY |
| Ga0082212_103909191 | 3300006045 | Termite Gut | MCAQCALVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMS |
| Ga0082212_103958481 | 3300006045 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLKQR |
| Ga0082212_104150144 | 3300006045 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTR |
| Ga0082212_104635023 | 3300006045 | Termite Gut | MCAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYG |
| Ga0082212_105782571 | 3300006045 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTLRVNMESCYGG |
| Ga0082212_105865241 | 3300006045 | Termite Gut | MRAQCVLVTTTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLKQR |
| Ga0082212_106200191 | 3300006045 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVMVVCQR |
| Ga0123357_101140651 | 3300009784 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKTVRVSMESCYG |
| Ga0123357_101276992 | 3300009784 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVSMESCYGGMSTRLKQRAV |
| Ga0123357_101311362 | 3300009784 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVSMESCYGGMSTRLKQ |
| Ga0123357_107076441 | 3300009784 | Termite Gut | MRTQCVLVATTLLHSGAKFHSFLYTGSRTVHVSMESCYGGMST |
| Ga0123357_108626361 | 3300009784 | Termite Gut | MRTQCVLVATTLLHSGAKFHSFLYTGSKTVLVSMESCYGGM |
| Ga0123355_100676847 | 3300009826 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVSMES |
| Ga0123355_101564966 | 3300009826 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKTVRVSMESCYGGMSTR |
| Ga0123355_118482201 | 3300009826 | Termite Gut | MRTQCVLVATTLLHSGAKFHSFLYTGSKTVLVSMESCYGGMSTR |
| Ga0123356_108531453 | 3300010049 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVSMESCYG |
| Ga0131853_1000781413 | 3300010162 | Termite Gut | MRIQCVLVAKTLLHSSAKFHSFLYTGSKTVRVNMESCYGGM* |
| Ga0131853_100343191 | 3300010162 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGG |
| Ga0131853_100872095 | 3300010162 | Termite Gut | MHAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTR |
| Ga0123353_102319082 | 3300010167 | Termite Gut | MLAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCY |
| Ga0209531_102217311 | 3300027558 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| Ga0209531_102470342 | 3300027558 | Termite Gut | MRAQFVLVATIPLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| Ga0209423_101925212 | 3300027670 | Termite Gut | MRAQCVLVAKTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRL |
| Ga0209755_100406242 | 3300027864 | Termite Gut | MRAQCVLVATTLLHSSVKFHSFLYTSSKTVRVNMES |
| Ga0209755_101541092 | 3300027864 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTGSKRVRDNMESCYGSMSTRLQ |
| Ga0209755_102141072 | 3300027864 | Termite Gut | MRTQCVLVATTLLHSGEKFHSFLYTGSKRVRVNMESCYASMSMRL |
| Ga0209755_105664211 | 3300027864 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMETCYGGMST |
| Ga0209755_106649661 | 3300027864 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRL |
| Ga0209755_106930251 | 3300027864 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNME |
| Ga0209755_106936852 | 3300027864 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYG |
| Ga0209755_109215731 | 3300027864 | Termite Gut | MCAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMELFYSGM |
| Ga0209755_111551931 | 3300027864 | Termite Gut | MRAQCALVATTLLHSSAKFHSFLYTGSKTVRVNMESCYGSMSTRL |
| Ga0209755_112353541 | 3300027864 | Termite Gut | MRAHCVHVATTLLHSGAKFHSFLYTGSKTVRVNMESCYG |
| Ga0209628_101819781 | 3300027891 | Termite Gut | MHAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYDGM |
| Ga0209628_103173671 | 3300027891 | Termite Gut | MCAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCYGGM |
| Ga0209628_103933331 | 3300027891 | Termite Gut | MRVQCVLVGTTLLHSGAKFHSFLYTGSKTVRVNMESCYGGM |
| Ga0209737_102420581 | 3300027904 | Termite Gut | MRTQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESC |
| Ga0209737_103575662 | 3300027904 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCY |
| Ga0209737_109079482 | 3300027904 | Termite Gut | MHAQCVLVATTLLHSSAKFHSFLYTGSKTVRVNMESCYGGMSTRLK |
| Ga0209627_12381501 | 3300027960 | Termite Gut | MRAQCVLVATTLLHSSAKFHSFLYTSSKTVRVNMESCYGGMSMRLR |
| Ga0209738_100571361 | 3300027966 | Termite Gut | MRAQCVRVATTLLHSGAKFHSFLYTGSKTVRVNMESCYG |
| Ga0209738_101410322 | 3300027966 | Termite Gut | MRARCVLAATTLLHSGAKFHSFLYTGSKTVRVNMESCYGG |
| Ga0209738_102245351 | 3300027966 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLKQ |
| Ga0209738_103615141 | 3300027966 | Termite Gut | MHAQCVLVATTLLHSGAKFHSFLYTGSKTVHVNME |
| Ga0209629_100411454 | 3300027984 | Termite Gut | MHAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESC |
| Ga0209629_101567871 | 3300027984 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVSME |
| Ga0209629_105168711 | 3300027984 | Termite Gut | MRTQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYG |
| Ga0268261_100485641 | 3300028325 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMSTRLKQRAM |
| Ga0268261_103372441 | 3300028325 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVKMESCYGGMSTR |
| Ga0268261_104205191 | 3300028325 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGM |
| Ga0268261_104967412 | 3300028325 | Termite Gut | MCAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMST |
| Ga0268261_107531881 | 3300028325 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESCYGGMST |
| Ga0268261_107562341 | 3300028325 | Termite Gut | MRAQCVLVATTLLHSGAKFHSFLYTGSKTVRVNMESC |
| ⦗Top⦘ |