


| Basic Information | |
|---|---|
| Family ID | F087832 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 62.73 % |
| % of genes near scaffold ends (potentially truncated) | 43.64 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.818 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (33.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.84% β-sheet: 0.00% Coil/Unstructured: 51.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00211 | Guanylate_cyc | 4.55 |
| PF00877 | NLPC_P60 | 4.55 |
| PF13191 | AAA_16 | 3.64 |
| PF13442 | Cytochrome_CBB3 | 1.82 |
| PF00536 | SAM_1 | 1.82 |
| PF02556 | SecB | 0.91 |
| PF00072 | Response_reg | 0.91 |
| PF03401 | TctC | 0.91 |
| PF13561 | adh_short_C2 | 0.91 |
| PF04392 | ABC_sub_bind | 0.91 |
| PF07969 | Amidohydro_3 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 4.55 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 4.55 |
| COG1952 | Preprotein translocase subunit SecB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.91 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.91 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.82 % |
| All Organisms | root | All Organisms | 28.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01DQ9A7 | Not Available | 519 | Open in IMG/M |
| 2170459005|F1BAP7Q02J05Z1 | Not Available | 538 | Open in IMG/M |
| 2170459010|GIO7OMY02F2IDC | Not Available | 526 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101771893 | Not Available | 1146 | Open in IMG/M |
| 3300002077|JGI24744J21845_10070847 | Not Available | 636 | Open in IMG/M |
| 3300002568|C688J35102_120858121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1854 | Open in IMG/M |
| 3300003575|Ga0007409J51694_1032050 | Not Available | 539 | Open in IMG/M |
| 3300004081|Ga0063454_100102470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1370 | Open in IMG/M |
| 3300004157|Ga0062590_100282938 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300005147|Ga0066821_1012133 | Not Available | 641 | Open in IMG/M |
| 3300005160|Ga0066820_1007144 | Not Available | 682 | Open in IMG/M |
| 3300005165|Ga0066869_10055883 | Not Available | 707 | Open in IMG/M |
| 3300005334|Ga0068869_100176981 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300005335|Ga0070666_10687745 | Not Available | 750 | Open in IMG/M |
| 3300005437|Ga0070710_10054816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2250 | Open in IMG/M |
| 3300005438|Ga0070701_11233971 | Not Available | 532 | Open in IMG/M |
| 3300005834|Ga0068851_10356741 | Not Available | 852 | Open in IMG/M |
| 3300005842|Ga0068858_100395396 | Not Available | 1327 | Open in IMG/M |
| 3300006163|Ga0070715_10062882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1635 | Open in IMG/M |
| 3300006577|Ga0074050_12077090 | Not Available | 625 | Open in IMG/M |
| 3300007788|Ga0099795_10593571 | Not Available | 526 | Open in IMG/M |
| 3300009098|Ga0105245_10013178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7203 | Open in IMG/M |
| 3300009098|Ga0105245_11248360 | Not Available | 791 | Open in IMG/M |
| 3300009143|Ga0099792_10456749 | Not Available | 792 | Open in IMG/M |
| 3300009176|Ga0105242_10952621 | Not Available | 862 | Open in IMG/M |
| 3300009545|Ga0105237_10757515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300010046|Ga0126384_11230689 | Not Available | 692 | Open in IMG/M |
| 3300010047|Ga0126382_11936887 | Not Available | 559 | Open in IMG/M |
| 3300010147|Ga0126319_1556290 | Not Available | 522 | Open in IMG/M |
| 3300010154|Ga0127503_10747183 | Not Available | 700 | Open in IMG/M |
| 3300010397|Ga0134124_10118725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2325 | Open in IMG/M |
| 3300011107|Ga0151490_1407705 | Not Available | 601 | Open in IMG/M |
| 3300011119|Ga0105246_10827043 | Not Available | 824 | Open in IMG/M |
| 3300012212|Ga0150985_105634885 | Not Available | 553 | Open in IMG/M |
| 3300012916|Ga0157310_10179568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 754 | Open in IMG/M |
| 3300012924|Ga0137413_11099253 | Not Available | 629 | Open in IMG/M |
| 3300012937|Ga0162653_100022659 | Not Available | 858 | Open in IMG/M |
| 3300012987|Ga0164307_10400466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1011 | Open in IMG/M |
| 3300013306|Ga0163162_10642437 | Not Available | 1185 | Open in IMG/M |
| 3300013308|Ga0157375_12593883 | Not Available | 606 | Open in IMG/M |
| 3300014745|Ga0157377_10135671 | Not Available | 1508 | Open in IMG/M |
| 3300014969|Ga0157376_10357509 | Not Available | 1400 | Open in IMG/M |
| 3300015372|Ga0132256_102421673 | Not Available | 627 | Open in IMG/M |
| 3300017792|Ga0163161_11747559 | Not Available | 552 | Open in IMG/M |
| 3300017965|Ga0190266_10111084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1150 | Open in IMG/M |
| 3300017997|Ga0184610_1155578 | Not Available | 752 | Open in IMG/M |
| 3300018027|Ga0184605_10008170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3910 | Open in IMG/M |
| 3300018051|Ga0184620_10201694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 661 | Open in IMG/M |
| 3300018055|Ga0184616_10255359 | Not Available | 665 | Open in IMG/M |
| 3300018066|Ga0184617_1057551 | Not Available | 1005 | Open in IMG/M |
| 3300018067|Ga0184611_1186678 | Not Available | 737 | Open in IMG/M |
| 3300018081|Ga0184625_10224408 | Not Available | 984 | Open in IMG/M |
| 3300018082|Ga0184639_10121577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1384 | Open in IMG/M |
| 3300018469|Ga0190270_10362806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1323 | Open in IMG/M |
| 3300019228|Ga0180119_1377729 | Not Available | 519 | Open in IMG/M |
| 3300019269|Ga0184644_1673697 | Not Available | 694 | Open in IMG/M |
| 3300019279|Ga0184642_1070784 | Not Available | 616 | Open in IMG/M |
| 3300019356|Ga0173481_10884173 | Not Available | 502 | Open in IMG/M |
| 3300019362|Ga0173479_10514405 | Not Available | 607 | Open in IMG/M |
| 3300019872|Ga0193754_1015237 | Not Available | 817 | Open in IMG/M |
| 3300019887|Ga0193729_1148049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 851 | Open in IMG/M |
| 3300021078|Ga0210381_10089655 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300021082|Ga0210380_10237907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300021951|Ga0222624_1173597 | Not Available | 803 | Open in IMG/M |
| 3300021953|Ga0213880_10190384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 162 | 573 | Open in IMG/M |
| 3300022756|Ga0222622_10199288 | Not Available | 1327 | Open in IMG/M |
| 3300025898|Ga0207692_10836033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300025903|Ga0207680_10320157 | Not Available | 1084 | Open in IMG/M |
| 3300025907|Ga0207645_10526619 | Not Available | 801 | Open in IMG/M |
| 3300026557|Ga0179587_10931154 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300027288|Ga0208525_1014304 | Not Available | 890 | Open in IMG/M |
| 3300027401|Ga0208637_1005259 | Not Available | 1195 | Open in IMG/M |
| 3300027560|Ga0207981_1091874 | Not Available | 558 | Open in IMG/M |
| 3300028608|Ga0247819_11081027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Motiliproteus → Motiliproteus coralliicola | 511 | Open in IMG/M |
| 3300028707|Ga0307291_1112146 | Not Available | 683 | Open in IMG/M |
| 3300028710|Ga0307322_10023943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 1419 | Open in IMG/M |
| 3300028712|Ga0307285_10093266 | Not Available | 790 | Open in IMG/M |
| 3300028716|Ga0307311_10249429 | Not Available | 527 | Open in IMG/M |
| 3300028719|Ga0307301_10129621 | Not Available | 807 | Open in IMG/M |
| 3300028719|Ga0307301_10137666 | Not Available | 783 | Open in IMG/M |
| 3300028720|Ga0307317_10180161 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300028721|Ga0307315_10073427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 980 | Open in IMG/M |
| 3300028778|Ga0307288_10138651 | Not Available | 909 | Open in IMG/M |
| 3300028784|Ga0307282_10180320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1006 | Open in IMG/M |
| 3300028790|Ga0307283_10084145 | Not Available | 810 | Open in IMG/M |
| 3300028807|Ga0307305_10217872 | Not Available | 875 | Open in IMG/M |
| 3300028809|Ga0247824_10112524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300028814|Ga0307302_10196230 | Not Available | 984 | Open in IMG/M |
| 3300028819|Ga0307296_10082666 | Not Available | 1711 | Open in IMG/M |
| 3300028876|Ga0307286_10216630 | Not Available | 697 | Open in IMG/M |
| 3300030905|Ga0308200_1027973 | Not Available | 948 | Open in IMG/M |
| 3300030988|Ga0308183_1092508 | Not Available | 677 | Open in IMG/M |
| 3300030993|Ga0308190_1125078 | Not Available | 588 | Open in IMG/M |
| 3300031058|Ga0308189_10418667 | Not Available | 558 | Open in IMG/M |
| 3300031093|Ga0308197_10074251 | Not Available | 945 | Open in IMG/M |
| 3300031114|Ga0308187_10325400 | Not Available | 585 | Open in IMG/M |
| 3300031125|Ga0308182_1004157 | Not Available | 971 | Open in IMG/M |
| 3300031170|Ga0307498_10323001 | Not Available | 584 | Open in IMG/M |
| 3300031184|Ga0307499_10159361 | Not Available | 668 | Open in IMG/M |
| 3300031198|Ga0307500_10033375 | Not Available | 1176 | Open in IMG/M |
| 3300031226|Ga0307497_10616611 | Not Available | 550 | Open in IMG/M |
| 3300031469|Ga0170819_15409248 | Not Available | 638 | Open in IMG/M |
| 3300031547|Ga0310887_10482685 | Not Available | 744 | Open in IMG/M |
| 3300031740|Ga0307468_100940116 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 754 | Open in IMG/M |
| 3300031910|Ga0306923_11585978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300031954|Ga0306926_10277219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2076 | Open in IMG/M |
| 3300032174|Ga0307470_10648262 | Not Available | 797 | Open in IMG/M |
| 3300034644|Ga0370548_032106 | Not Available | 864 | Open in IMG/M |
| 3300034644|Ga0370548_081590 | Not Available | 628 | Open in IMG/M |
| 3300034680|Ga0370541_033482 | Not Available | 627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 33.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 5.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.91% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_03627800 | 2170459005 | Grass Soil | MLAEIFMLRVEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| E41_07651700 | 2170459005 | Grass Soil | MLAEIFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| F62_03101940 | 2170459010 | Grass Soil | EIFMLRLEATARAAKEATAITRSTSPFVPVTLPPAKAS |
| INPhiseqgaiiFebDRAFT_1017718931 | 3300000364 | Soil | MLAEIFRLRLEXTAXAAREAATITRSTSPFVPITLPVPT |
| JGI24744J21845_100708472 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAEIFMLRLEATARVAKEAATITRSTSPFVPVTXPVPTPKAA* |
| C688J35102_1208581212 | 3300002568 | Soil | MSAEIFMLRLEATARVAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0007409J51694_10320501 | 3300003575 | Avena Fatua Rhizosphere | MSAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0063454_1001024702 | 3300004081 | Soil | MSAEIFMLRLEATARVAKEAATITRRTSPFVPVTLPVPTPKAA* |
| Ga0062590_1002829381 | 3300004157 | Soil | MLAEIYMLRLEATARAAKEAASTITRSTSAFVPVTLPPVKAS* |
| Ga0066821_10121331 | 3300005147 | Soil | MSAEIFMLRLEATARAAKEASTITRSTSPFVPVTLPVPTPKAA* |
| Ga0066820_10071441 | 3300005160 | Soil | MSAEIFMLRLEATARVAKEAATITRSTSPFVPVTVPVPTPKAA* |
| Ga0066869_100558832 | 3300005165 | Soil | EIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0068869_1001769814 | 3300005334 | Miscanthus Rhizosphere | IRLSPREARMSAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0070666_106877452 | 3300005335 | Switchgrass Rhizosphere | MSAEIFMLRLEATARAAKETATITRSTSPFVPVTLPVPTPKAA* |
| Ga0070710_100548164 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAEIFMLRLEATARAAKEGATITRSTSPFVPVTLPVPTPKAA* |
| Ga0070701_112339712 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | SPREARMSAEIFMLRLEATARVAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0068851_103567412 | 3300005834 | Corn Rhizosphere | MLAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0068858_1003953964 | 3300005842 | Switchgrass Rhizosphere | SPREARMSAEIFMLRLEATARAAKEAATITRSTSPFVPVTVPVPTPKAA* |
| Ga0070715_100628822 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAEIFMIRLEAVARAAKEAANSPRFVPVRLPLIKKGPARL* |
| Ga0074050_120770901 | 3300006577 | Soil | SPREARMSAEIFMLRLEATARAAKEAATIARSTSPFVPVTLPVPTPKAA* |
| Ga0099795_105935712 | 3300007788 | Vadose Zone Soil | LRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0105245_100131781 | 3300009098 | Miscanthus Rhizosphere | LEATARVAKEAATITRSTSPFVPVTVPVPTPKAA* |
| Ga0105245_112483602 | 3300009098 | Miscanthus Rhizosphere | MSAEIFMLRLEATARAAKEAVTITRSTSPFVPVTLPVPTPKAA* |
| Ga0099792_104567492 | 3300009143 | Vadose Zone Soil | MLAEIFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0105242_109526212 | 3300009176 | Miscanthus Rhizosphere | MSAEIFMLRLEATARAAKEAATITRSTSPCVHVTLPVPTPKAA* |
| Ga0105237_107575151 | 3300009545 | Corn Rhizosphere | HQGRARMSAGIFMLRLEATGRGAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0126384_112306892 | 3300010046 | Tropical Forest Soil | MLAEIFMLRMEAAARAAKETASTRFVPVTLPVPAPKASERA* |
| Ga0126382_119368871 | 3300010047 | Tropical Forest Soil | MLAEIFMLRMEAAARAAKEAASTRFVPVTLPVPAPKASERA* |
| Ga0126319_15562901 | 3300010147 | Soil | RMLAEIFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0127503_107471832 | 3300010154 | Soil | EIFLLRLEATARSAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0134124_101187252 | 3300010397 | Terrestrial Soil | MSAEIFMLRLEATGRGAKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0151490_14077051 | 3300011107 | Soil | FMLRLEATARAAKEGATITRSTSPFVPVTLPVPTPKAA* |
| Ga0105246_108270431 | 3300011119 | Miscanthus Rhizosphere | MSAEIFMLRLEATARAAKETATITRSTSPFVPVTLSVPTPKAA* |
| Ga0150985_1056348852 | 3300012212 | Avena Fatua Rhizosphere | MLAEIFFLRLEATARATKEATVTSSNSRFVPIALPTAKAS* |
| Ga0157310_101795683 | 3300012916 | Soil | MLAEIYMLRLEATARAAKEAASTITRSTSAFVPVTLPPVKA |
| Ga0137413_110992532 | 3300012924 | Vadose Zone Soil | MLAEIFMLRLEATARAGKEAATITRSTSPFVPVTLPVPTPKAA* |
| Ga0162653_1000226591 | 3300012937 | Soil | MLAEIFMLRLEATTRAAKEAATITRSTSPLVPVTLPVSTPKAA* |
| Ga0164307_104004661 | 3300012987 | Soil | MLRLEATARVAKEAATITRSTSPFVPVTVPVPTPKAA* |
| Ga0163162_106424374 | 3300013306 | Switchgrass Rhizosphere | MSAEIFMLRLEATARAAKETATITRSTSPFVPVTLPVPTP |
| Ga0157375_125938831 | 3300013308 | Miscanthus Rhizosphere | MSTEIFMLRLEATARAAKEAVTITRSTSPFVPVTLPVPTPKAA* |
| Ga0157377_101356711 | 3300014745 | Miscanthus Rhizosphere | MSAEIFMLRLEATARAAKEAATVTRSTSPFVPVTLPVPTPKAA* |
| Ga0157376_103575091 | 3300014969 | Miscanthus Rhizosphere | MSAEIFMLRLEATARVAKEAATITRSTSPFVPVTLPV |
| Ga0132256_1024216732 | 3300015372 | Arabidopsis Rhizosphere | ARMSAEIFMLRLEATARAAKEGATITRSTSPFVPVTLPVPTPKAA* |
| Ga0163161_117475591 | 3300017792 | Switchgrass Rhizosphere | MLAEIYMLRLEATARAAKEAASTITRSTSAFVPVTLPPVKAS |
| Ga0190266_101110842 | 3300017965 | Soil | MLAEIFMIRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0184610_11555782 | 3300017997 | Groundwater Sediment | MIGVSPREARMLAEIFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0184605_100081705 | 3300018027 | Groundwater Sediment | MLAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0184620_102016942 | 3300018051 | Groundwater Sediment | MLAEIFMLRLEATAWAAKEAATITRSTSPFVPITLPPVKAS |
| Ga0184616_102553592 | 3300018055 | Groundwater Sediment | AEIFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0184617_10575511 | 3300018066 | Groundwater Sediment | MLAEIFMLRLEATAGAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0184611_11866781 | 3300018067 | Groundwater Sediment | MLAEIFMIRLEATAWAAKEAATITRSTSPFVPFTLPVPTPKAA |
| Ga0184625_102244081 | 3300018081 | Groundwater Sediment | MLAEIFLLRLEAKARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0184639_101215773 | 3300018082 | Groundwater Sediment | MTGASPREARMLAEIFLLRLEAKARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0190270_103628063 | 3300018469 | Soil | MSAEIFMLRLEATARGAKEAATITRSTSPFVPVTLPVSTPKAA |
| Ga0180119_13777291 | 3300019228 | Groundwater Sediment | EIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0184644_16736972 | 3300019269 | Groundwater Sediment | MSAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0184642_10707841 | 3300019279 | Groundwater Sediment | RMLAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0173481_108841731 | 3300019356 | Soil | MSAEIFMLRLEATARVAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0173479_105144052 | 3300019362 | Soil | FMLRLEATARVAKEAATITRSTSPFVPVTVPVPTPKAA |
| Ga0193754_10152372 | 3300019872 | Soil | MLAEIFMLRLEATARAGKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0193729_11480492 | 3300019887 | Soil | MLAEIFMLLLEATARAAKEAATITRTTSPFVPITLPPVKAS |
| Ga0210381_100896553 | 3300021078 | Groundwater Sediment | MLRLEATARAAKEAATITRTTSPFVPITLPPVKAS |
| Ga0210380_102379072 | 3300021082 | Groundwater Sediment | MLAEIFFLRLEATARATKEATVTSSNSRFVPITLPT |
| Ga0222624_11735971 | 3300021951 | Groundwater Sediment | RMLAEIFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0213880_101903841 | 3300021953 | Exposed Rock | MLAEIFLLRLEATARAAGSTRTVSTSPFIPVVLPAQKPARSGE |
| Ga0222622_101992881 | 3300022756 | Groundwater Sediment | LLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0207692_108360332 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAEIFMIRLEAVARAAKEAANSPRFVPVRLPLIKKGPARL |
| Ga0207680_103201573 | 3300025903 | Switchgrass Rhizosphere | PKIRLSPREARMSAEIFMLRLEATARAAKETATITRSTSPFVPVTLPVPTPKAA |
| Ga0207645_105266192 | 3300025907 | Miscanthus Rhizosphere | MSAEIFMLRLEATARVAKEAATITRSTSPFVPVTVPVPTPKAA |
| Ga0179587_109311542 | 3300026557 | Vadose Zone Soil | MLAEIFLLRLEATARAAKEAATITRSTSPFVPVTL |
| Ga0208525_10143041 | 3300027288 | Soil | MSAEIFMLRLEATGRGAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0208637_10052593 | 3300027401 | Soil | MSAEIFMLRLEATARAAKEAATITRSTSPFVPVTLLVPTPKAA |
| Ga0207981_10918741 | 3300027560 | Soil | PREARMSAEIFMLRLEATARVAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0247819_110810271 | 3300028608 | Soil | MSAEIFMLRLDATARGAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307291_11121462 | 3300028707 | Soil | AEIFMLRLEARAGAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307322_100239431 | 3300028710 | Soil | FMLRLQATARAAKEAATITRSTSPFVPITLPPVKAS |
| Ga0307285_100932661 | 3300028712 | Soil | FLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307311_102494292 | 3300028716 | Soil | MLAEIFLLRLEATARAAKEAATITRSTSPFVPATLPVPTPKAA |
| Ga0307301_101296211 | 3300028719 | Soil | EARMLAEVFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307301_101376662 | 3300028719 | Soil | MLAEIFMLRLEATAWAAKEAATITRSTSPFVPVTLPVPKAA |
| Ga0307317_101801611 | 3300028720 | Soil | MLAEIFMLRLEATAWAAKEAATITRSTSPFVPVTLPVP |
| Ga0307315_100734273 | 3300028721 | Soil | MLAEIFMLRLEATTRAAKEAATITRSTSPLVPVTLPVSTPKAA |
| Ga0307288_101386512 | 3300028778 | Soil | MLAEIFFLRLEATARATKEATVTSSNSRFVPITPPTAKAP |
| Ga0307282_101803204 | 3300028784 | Soil | FMLRLEATAGAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307283_100841452 | 3300028790 | Soil | LAEVFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307305_102178721 | 3300028807 | Soil | IIGLLPREARMLAEVFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0247824_101125241 | 3300028809 | Soil | MSAEIFMLRLEATARGAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307302_101962301 | 3300028814 | Soil | REARMLAEVFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307296_100826663 | 3300028819 | Soil | MLAEIFMLRLEARAGAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307286_102166302 | 3300028876 | Soil | MLAEIFMLRLEATARAAKEAATITRSTSPFVPITLPPVKAS |
| Ga0308200_10279731 | 3300030905 | Soil | MLAEVFLLRLEATARAAKEAATITRSTSPFGPVTLPVPTPKAA |
| Ga0308183_10925081 | 3300030988 | Soil | RMLAEIFMLRLEATAWAAKEAATITRSTSPFVPVTLPVPKAA |
| Ga0308190_11250782 | 3300030993 | Soil | LAEIFMIRLEATAWAAKEAATITRSTSPFVPVTLPVPKAA |
| Ga0308189_104186671 | 3300031058 | Soil | RMLAEIFMLRLEATAWAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0308197_100742511 | 3300031093 | Soil | PSPREARMLAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0308187_103254001 | 3300031114 | Soil | TINPSPREARMLAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0308182_10041573 | 3300031125 | Soil | MLAEIFMLRLEATARAAKEAATITRSTAPFVPVTLPVPTPKAA |
| Ga0307498_103230011 | 3300031170 | Soil | LRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307499_101593611 | 3300031184 | Soil | LRLEATARSAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307500_100333751 | 3300031198 | Soil | MSAEIFMLRLEATARAAKETATITRSTSPFVPVTLPVPTPKAA |
| Ga0307497_106166112 | 3300031226 | Soil | MLAEIFLLRLEATARSAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0170819_154092482 | 3300031469 | Forest Soil | MSAEIFMLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAV |
| Ga0310887_104826851 | 3300031547 | Soil | MSAEIFMLRLEAMARVAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0307468_1009401162 | 3300031740 | Hardwood Forest Soil | MSAEIFMMRLETTARAAREAATITRSTSPFVPVTLPVPTPKAA |
| Ga0306923_115859782 | 3300031910 | Soil | MLAEIFMLRLEATARAAKEAANSSRFVPITLPTAKASQIPT |
| Ga0306926_102772194 | 3300031954 | Soil | MLAEIFMLRLEATARAAKEAANSSRFVPITLPTAKAS |
| Ga0307470_106482622 | 3300032174 | Hardwood Forest Soil | MSAEIFMMRLETTARAAREAATITRSTSPFVPVTLPMPTPKAA |
| Ga0370548_032106_643_756 | 3300034644 | Soil | MLRLEATTRAAKEAATITRSTSPLVPVTLPVPTPKAA |
| Ga0370548_081590_6_137 | 3300034644 | Soil | MLAEVFLLRLEATARAAKEAATITRSTSPFVPVTLPVPTPKAA |
| Ga0370541_033482_6_137 | 3300034680 | Soil | MLAEIFMLRLEATARAAKEAATITRSTSPFVPVALPVPTPKAA |
| ⦗Top⦘ |