


| Basic Information | |
|---|---|
| Family ID | F087765 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MIQRGRKYVVYDKHEKVVIITVDRNIAVQYARRQK |
| Number of Associated Samples | 50 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.91 % |
| % of genes near scaffold ends (potentially truncated) | 14.55 % |
| % of genes from short scaffolds (< 2000 bps) | 76.36 % |
| Associated GOLD sequencing projects | 41 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.636 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (29.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.46% β-sheet: 20.63% Coil/Unstructured: 61.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF11351 | GTA_holin_3TM | 34.55 |
| PF00565 | SNase | 2.73 |
| PF13539 | Peptidase_M15_4 | 1.82 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.82 |
| PF13884 | Peptidase_S74 | 0.91 |
| PF03237 | Terminase_6N | 0.91 |
| PF04404 | ERF | 0.91 |
| PF04218 | CENP-B_N | 0.91 |
| PF00166 | Cpn10 | 0.91 |
| PF13661 | 2OG-FeII_Oxy_4 | 0.91 |
| PF00036 | EF-hand_1 | 0.91 |
| PF01521 | Fe-S_biosyn | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.64 % |
| All Organisms | root | All Organisms | 26.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 29.09% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 27.27% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 20.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.55% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.82% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.91% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.91% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100054959 | 3300000101 | Marine | VILVQRGKNYVVYDKQKKVVIITREKNIAVQYARQQK* |
| DelMOSum2010_100178966 | 3300000101 | Marine | MMQRGKNYVVYDKHEKVVIITVDRNIAIQYARRLK* |
| DelMOSum2010_100192183 | 3300000101 | Marine | MVQKGRKYIVYDKHEKIVIITVDRNIAVQYARGQYDRV* |
| DelMOSum2010_101476941 | 3300000101 | Marine | VILIQRGKNYVVYDKDGKVVIITVDRHIAINYARQQK* |
| DelMOSpr2010_101084353 | 3300000116 | Marine | VILVQRGKNYVVYDKRGKVVIITVDRHIAISYARQQK* |
| JGI20156J14371_101410592 | 3300001347 | Pelagic Marine | VILVQKGKKYVVYGKRGKVVIITSHKNIAKGYARSLTDD* |
| JGI24006J15134_1000077224 | 3300001450 | Marine | VILVQRGKNYVVYDKDEKVIIITREKNIAVQYARSQYVGVR* |
| JGI24006J15134_100446063 | 3300001450 | Marine | VLIQKNKKYVVYDKLGKVVIITVDRNAAISYAKNKCGRI* |
| JGI24006J15134_100673111 | 3300001450 | Marine | MVQKGRKYVVYDKDEKVVIITVDRHIAINYARQQK* |
| JGI24006J15134_100752033 | 3300001450 | Marine | VILVQKGRKYVVYDKYEKVVIITVDRHIAVNYARQQK* |
| JGI24006J15134_101632023 | 3300001450 | Marine | LIQRGKNYVVYDKDGKVVIITVDRHIAINYARGKYGRI* |
| JGI24006J15134_102075652 | 3300001450 | Marine | VVLVQRGKNYVVYDKRGKVVIITVDRHIAVNYARQQK* |
| JGI24003J15210_100176046 | 3300001460 | Marine | MVQKGKKYIVYDKHEKIVIITVDRNIAVQYARGQYDRV* |
| JGI24003J15210_101836722 | 3300001460 | Marine | MVQRGRNYVVYDKYEKVVIITVDRHIAVNYARQKK* |
| JGI24004J15324_100705192 | 3300001472 | Marine | MVQRGRKYVVYDKYEKVVIITVDRHIAVNYARQQK* |
| JGI24004J15324_100916552 | 3300001472 | Marine | MVQRGKNYVVYDKRGKVVIITVDRHIAVNYARSKYGRI* |
| Ga0075478_100640763 | 3300006026 | Aqueous | VILVQRGKNYVVYDKRGKVVIITVDRHIAVNYARQQK* |
| Ga0075478_101749603 | 3300006026 | Aqueous | RTRQVVMVQRGRNYVVYDKDKKVVIITVDRHIAVNYARQQK* |
| Ga0075441_100764424 | 3300006164 | Marine | MVQRGRKYVVYDKRGKVVIITLDRNIAVQYVRGKYGRI* |
| Ga0075441_102551952 | 3300006164 | Marine | MIQRGKKYVVYDKHEKVVIITIDRHIAAQYARRQNDRF* |
| Ga0075443_100764812 | 3300006165 | Marine | MIQRGRKYVVYDKRGKVVIITLDRNIAVQYVRGKYGRI* |
| Ga0075443_102079532 | 3300006165 | Marine | MVQNGKKYVVYDKLGKVVIITVDRNVAINYARGNYSKN* |
| Ga0075446_100229065 | 3300006190 | Marine | MVQRGRKYVVYDKHGKIVIITIDRNIAINYARVRYGI* |
| Ga0075446_102249502 | 3300006190 | Marine | MIQRGRKYVVYDKQGKVVIITLNKNIAVQYVRGKYGRV* |
| Ga0075447_100736275 | 3300006191 | Marine | MIQRGRKYVVYDKYEKVVIITVDRNIAVQYARRQK* |
| Ga0075447_100763691 | 3300006191 | Marine | GRKYVVYDKHEKVVIITVDRNIALNYARGKYGGI* |
| Ga0075447_101630902 | 3300006191 | Marine | MIQRGRKYVVYDKHEKVVIITVDRNIAVQYARRQK* |
| Ga0075447_102104833 | 3300006191 | Marine | MIQRGRKYVVYDKDEKVVIITVDRHIAINYARGKYGGIR* |
| Ga0075445_100317186 | 3300006193 | Marine | MVQNGKKYVVYDKLGKVVIITIDRNVAINYARGNYSKN* |
| Ga0075448_100519392 | 3300006352 | Marine | MIQRGKKYVVYDKHEKVVIITVDRHIAAQYARRQK* |
| Ga0075448_100633454 | 3300006352 | Marine | RSRQVVMIQRGRKYVVYDKDEKVVIITVDRNIAVQYARRQK* |
| Ga0075448_101094942 | 3300006352 | Marine | MIQRGRKYVVYDKDEKVVIITVDRNIAVQYARRQK* |
| Ga0070749_105452832 | 3300006802 | Aqueous | VILIQRGKNYVVYDKDGKVVIITVDRHIAVNYARQQK* |
| Ga0070754_101456503 | 3300006810 | Aqueous | MVQRGRNYVVYDKDKKVVIITVDRHIAVNYARQQK* |
| Ga0075444_100076896 | 3300006947 | Marine | MVQRGRKYVVYDKRGKVVIITLDKNIAVQYVRGKYGRV* |
| Ga0075444_102505462 | 3300006947 | Marine | MVQKGRKYVVYDKDEKVVIITVDRHIAINYARGKYGGIR* |
| Ga0075444_102512581 | 3300006947 | Marine | MVQKGRKYVVYDKHEKVVIITVDRNIAVQYARRQHDRVR* |
| Ga0075444_103069892 | 3300006947 | Marine | MIQRGRKYVVYDKHEKVVIITVDRNIALNYARGKYGGI* |
| Ga0070745_10254434 | 3300007344 | Aqueous | VILVQRGKNYVVYDKHKKVVIITVDRHIAINYARQQK* |
| Ga0114916_10823531 | 3300008221 | Deep Ocean | MIQRGRKYVVYDKHGKIVIITIDRNIAINYARVRYGI* |
| Ga0114995_102613493 | 3300009172 | Marine | VILIQRGKNYVVYDKDGKVVIITVDRHIAINYARGKYGRI* |
| Ga0114993_102176202 | 3300009409 | Marine | VTLIQRGKNYVVYDKDGKVVIITVDRHIAVNYARQKK* |
| Ga0114915_10637023 | 3300009428 | Deep Ocean | MVQKGRKYIVYDKHEKIVIITVDRNIAVQYARGKYGGI* |
| Ga0114915_10738814 | 3300009428 | Deep Ocean | MVQKGRKYVVYDKYEKVVIITVDRNIALNYARGKYGGIR* |
| Ga0114915_10741152 | 3300009428 | Deep Ocean | MVQKGRKYVVYDKYEKVVIITVDRNIAVNYARGRYGI* |
| Ga0114915_10895483 | 3300009428 | Deep Ocean | MVQRGRNYVVYDKDEKVVIITVNKHIAINYARQQK* |
| Ga0114915_11520552 | 3300009428 | Deep Ocean | MVQKGRKYVVYDKDEKVVIITVDRHIAINYARGKYGGI |
| Ga0114914_10021566 | 3300009601 | Deep Ocean | MVQRGKKYIVYDKHEKVVIITVDRNIAVQYARGKYGGI* |
| Ga0115001_1001339012 | 3300009785 | Marine | VQKGKNYVVYDKRGKVVIITVDRHIAISYARQQK* |
| Ga0118731_1129392863 | 3300010392 | Marine | VQKGKKYVVYGERGKVVIITSHKNIAKGYARSLTDD* |
| Ga0133547_111672146 | 3300010883 | Marine | LVQRGKNYVVYDKQKKVVIITREKNIAVQYARQQK* |
| Ga0133547_114274702 | 3300010883 | Marine | VILIQRGKNYVVYDKRGKVVIITVDRHIAVNYARQQK* |
| Ga0133547_114576522 | 3300010883 | Marine | VVLIQKNKKYVVYDKLGKVVIITVDRNAAISYAKNKCGRI* |
| Ga0133547_119259232 | 3300010883 | Marine | MVQRGRKYVVYDKHEKVVIITVDRNIAIQYARRLK* |
| Ga0180120_101805822 | 3300017697 | Freshwater To Marine Saline Gradient | MMQRGKNYVVYDKHEKVVIITVDRNIAIQYARRLK |
| Ga0212030_10253602 | 3300022053 | Aqueous | VILVQRGKNYVVYDKRGKVVIITVDRHIAVNYARQQK |
| Ga0196887_10082137 | 3300022178 | Aqueous | MVQKGRKYIVYDKHEKIVIITVDRNIAVQYARGQYDRV |
| Ga0207905_10655222 | 3300025048 | Marine | VVLVQRGKNYVVYDKRGKVVIITVDRHIAVNYARQQK |
| Ga0207896_10176262 | 3300025071 | Marine | VILIQRGKNYVVYDKDGKVVIITVDRHIAVNYARQKK |
| Ga0209535_10183097 | 3300025120 | Marine | MVQKGRKYVVYDKDEKVVIITVDRHIAINYARQQK |
| Ga0209535_10769373 | 3300025120 | Marine | MVQRGKNYVVYDKHEKVVIITVDRNIAIQYARRLK |
| Ga0209535_10951842 | 3300025120 | Marine | VILVQKGRKYVVYDKDEKVVIITVDRHIAVNYARQQK |
| Ga0209535_10951852 | 3300025120 | Marine | VILVQKGRKYVVYDKYEKVVIITVDRHIAVNYARQQK |
| Ga0209535_11163412 | 3300025120 | Marine | MVQRGKNYVVYDKDGKVVIITVDRHIAINYARQQK |
| Ga0209535_11428302 | 3300025120 | Marine | MVQRGRKYVVYDKYEKVVIITVDRHIAVNYARQQK |
| Ga0209336_101471343 | 3300025137 | Marine | WVILIQRGKNYVVYDKDGKVVIITVDRHIAINYARGKYGRI |
| Ga0209634_10407225 | 3300025138 | Marine | VVLIQKNKKYVVYDKLGKVVIITVDRNAAISYAKNKCGRI |
| Ga0209634_10656985 | 3300025138 | Marine | MVQRGRNYVVYDKYEKVVIITVDRHIAVNYARQKK |
| Ga0209634_10851563 | 3300025138 | Marine | VILVQKGKKYIVYDKHEKIVIITVDRNIAVQYARGQYDRV |
| Ga0209634_11454151 | 3300025138 | Marine | VILIQRGKNYVVYDKDGKVVIITVDRHIAINYARQQK |
| Ga0209337_10234707 | 3300025168 | Marine | VILIQRGKNYVVYDKDGKVVIITVDRHIAINYARGKYGRI |
| Ga0208031_10136062 | 3300025237 | Deep Ocean | MIQRGKKYVVYDKHEKVVIITIDRNIATQYARRQNDRF |
| Ga0208031_10194942 | 3300025237 | Deep Ocean | MIQRGRKYVVYDKHEKVVIITVDRNIAVQYARRQK |
| Ga0208031_10287332 | 3300025237 | Deep Ocean | MIQRGRKYVVYDKDEKVVIITVDRNIAVQYARRQK |
| Ga0208031_10330862 | 3300025237 | Deep Ocean | MVQKGKKYIVYDKHEKVVIITVDRNIAVQYARGKYGGI |
| Ga0208031_10527872 | 3300025237 | Deep Ocean | IQRGRKYVVYDKHGKIVIITIDRNIAINYARVRYGI |
| Ga0208032_10058676 | 3300025266 | Deep Ocean | MVQRGKKYIVYDKHEKVVIITVDRNIAVQYARGKYGGI |
| Ga0208032_10286321 | 3300025266 | Deep Ocean | QVVMIQRGKKYVVYDKHEKVVIITVDRNIAVQYARRQHDRVR |
| Ga0208032_10290723 | 3300025266 | Deep Ocean | MIQRGRKYVVYDKHEKVVIITVDRNIALNYARGKYGGI |
| Ga0208032_10316262 | 3300025266 | Deep Ocean | MIQRGKKYVVYDKHEKVVIITVDRHIAVQYARRQK |
| Ga0208032_10326755 | 3300025266 | Deep Ocean | RGKKYVVYDKHEKVVIITIDRNIATQYARRQNDRF |
| Ga0208032_10387491 | 3300025266 | Deep Ocean | VMIQRGKKYVVYDKHEKVVIITVDRHIAAQYARRQK |
| Ga0208032_10690183 | 3300025266 | Deep Ocean | MVQKGRKYVVYDKDEKVVIITVDRHIAINYARGKYGGIR |
| Ga0208814_10003086 | 3300025276 | Deep Ocean | MIQRGRKYVVYDKRGKVVIITLDRNIAVQYVRGKYGRI |
| Ga0208814_10037156 | 3300025276 | Deep Ocean | MVQRGRKYVVYDKRGKVVIITLDKNIAVQYVRGKYGRV |
| Ga0208814_10104476 | 3300025276 | Deep Ocean | MVQKGRKYIVYDKHEKIVIITVDRNIAVQYARGKYGGI |
| Ga0208814_10171388 | 3300025276 | Deep Ocean | MVQKGRKYVVYDKHEKVVIITVDRNIAVQYARRQHDRVR |
| Ga0208814_10338876 | 3300025276 | Deep Ocean | MVQRGRKYVVYDKHGKIVIITIDRNIAINYARVRYGI |
| Ga0208814_10462801 | 3300025276 | Deep Ocean | MVQKGRKYVVYDKYEKVVIITVDRNIALNYARGKYGGIR |
| Ga0208814_10716572 | 3300025276 | Deep Ocean | MVQRGRKYVVYDKYEKVVIITVDRNIAVQYARRQK |
| Ga0208814_10796832 | 3300025276 | Deep Ocean | MIQRGRKYVVYDKYEKVVIITVDRNIAVQYARRQK |
| Ga0208814_10891932 | 3300025276 | Deep Ocean | MVQRGRKYVVYDKYEKVVIITVDRNIAVQYARRQHDRV |
| Ga0208814_10982432 | 3300025276 | Deep Ocean | MIQRGRKYVVYDKQGKVVIITLNKNIAVQYVRGKYGRV |
| Ga0208814_11199053 | 3300025276 | Deep Ocean | VVMVQKGRKYVVYDKHEKVVIITVDRNIAVQYARRQHDRV |
| Ga0209405_10248966 | 3300025620 | Pelagic Marine | VILVQKGKKYVVYGKRGKVVIITSHKNIAKGYARSLTDD |
| Ga0208162_10599775 | 3300025674 | Aqueous | MVQRGRNYVVYDKDKKVVIITVDRHIAVNYARQQK |
| Ga0209406_10665125 | 3300025694 | Pelagic Marine | VILVQKGKKYVVYGKRGKVVIITSHKNIAKGYARS |
| Ga0208545_10193385 | 3300025806 | Aqueous | VILVQRGKNYVVYDKQKKVVIITREKNIAVQYARQQK |
| Ga0208644_11103935 | 3300025889 | Aqueous | VILVQKGKNYVVYDKRGKVVIITVDRHIAISYARQQ |
| Ga0209384_10055954 | 3300027522 | Marine | MIQRGKKYVVYDKHEKVVIITIDRHIAAQYARRQK |
| Ga0209384_10156534 | 3300027522 | Marine | MIQRGRKYVVYDKDEKVVIITVDRHIAINYARGKYGGIR |
| Ga0209384_11109223 | 3300027522 | Marine | MVQNGKKYVVYDKLGKVVIITVDRNVAINYARGNYSKN |
| Ga0209384_11481332 | 3300027522 | Marine | MIQRGKKYVVYDKHEKVVIITIDRHIAAQYARRQNDRF |
| Ga0209383_100062210 | 3300027672 | Marine | MIQRGKKYVVYDKHEKVVIITVDRHIAAQYARRQK |
| Ga0256368_10178803 | 3300028125 | Sea-Ice Brine | VILVQKGKNYVVYDKRGKVVIITVDRHIAINYARQQK |
| Ga0307488_102827781 | 3300031519 | Sackhole Brine | VILIQRGKNYVVYDKRGKVVIITVDRHIAVNYARQKK |
| Ga0308019_102302302 | 3300031598 | Marine | VVLMQNGKKYVVYDKLGKVVIITVDRNVAINYARGKYGKN |
| Ga0302121_100228172 | 3300031626 | Marine | MVQRGRKYVVYDKHEKVVIITVDRNIAIQYARRLK |
| Ga0314858_132381_1_108 | 3300033742 | Sea-Ice Brine | GIQRGKNYVVYDKDGKVVIITVDRHIAINYARQQK |
| Ga0348336_082003_762_875 | 3300034375 | Aqueous | VILIQRGKNYVVYDKDGKVVIITVDRHIAVNYARQQK |
| ⦗Top⦘ |