


| Basic Information | |
|---|---|
| Family ID | F087737 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 38 residues |
| Representative Sequence | PKAFASLDLEIIQPSLLDKTTTGFFLILGLNNLSQET |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 96.36 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.091 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (28.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (77.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00717 | Peptidase_S24 | 76.36 |
| PF04828 | GFA | 8.18 |
| PF04832 | SOUL | 3.64 |
| PF02321 | OEP | 1.82 |
| PF00485 | PRK | 1.82 |
| PF02803 | Thiolase_C | 0.91 |
| PF00497 | SBP_bac_3 | 0.91 |
| PF05193 | Peptidase_M16_C | 0.91 |
| PF11127 | DUF2892 | 0.91 |
| PF00463 | ICL | 0.91 |
| PF00378 | ECH_1 | 0.91 |
| PF00817 | IMS | 0.91 |
| PF00905 | Transpeptidase | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 8.18 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 3.64 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.91 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.91 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.09 % |
| All Organisms | root | All Organisms | 40.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573025|GS310G0146KB_1113212522872 | Not Available | 812 | Open in IMG/M |
| 3300000756|JGI12421J11937_10057483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter | 1227 | Open in IMG/M |
| 3300001974|GOS2246_10112050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1427 | Open in IMG/M |
| 3300002033|GOS24894_10132580 | Not Available | 1560 | Open in IMG/M |
| 3300002033|GOS24894_10348070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1996 | Open in IMG/M |
| 3300002033|GOS24894_10470032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1996 | Open in IMG/M |
| 3300005593|Ga0066837_10299103 | Not Available | 564 | Open in IMG/M |
| 3300005948|Ga0066380_10087086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300005951|Ga0066379_10249832 | Not Available | 576 | Open in IMG/M |
| 3300006013|Ga0066382_10231803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300006019|Ga0066375_10158909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300006166|Ga0066836_10182673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1242 | Open in IMG/M |
| 3300006313|Ga0068472_10336842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2769 | Open in IMG/M |
| 3300006313|Ga0068472_10376170 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300006313|Ga0068472_10379617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300006313|Ga0068472_10475757 | Not Available | 672 | Open in IMG/M |
| 3300006316|Ga0068473_1735488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300006323|Ga0068497_1331961 | Not Available | 522 | Open in IMG/M |
| 3300006331|Ga0068488_1324367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1109 | Open in IMG/M |
| 3300006331|Ga0068488_1434960 | Not Available | 819 | Open in IMG/M |
| 3300006338|Ga0068482_1258814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1225 | Open in IMG/M |
| 3300006565|Ga0100228_1089107 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006902|Ga0066372_10348661 | Not Available | 846 | Open in IMG/M |
| 3300006902|Ga0066372_10651263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300007647|Ga0102855_1195452 | Not Available | 540 | Open in IMG/M |
| 3300007670|Ga0102862_1119899 | Not Available | 665 | Open in IMG/M |
| 3300008249|Ga0105353_1125987 | Not Available | 607 | Open in IMG/M |
| 3300008253|Ga0105349_10455348 | Not Available | 534 | Open in IMG/M |
| 3300009049|Ga0102911_1103231 | Not Available | 816 | Open in IMG/M |
| 3300009054|Ga0102826_1131508 | Not Available | 596 | Open in IMG/M |
| 3300009058|Ga0102854_1030236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1561 | Open in IMG/M |
| 3300009077|Ga0115552_1291010 | Not Available | 653 | Open in IMG/M |
| 3300009132|Ga0118730_1148317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1456 | Open in IMG/M |
| 3300009142|Ga0102885_1010094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2175 | Open in IMG/M |
| 3300009155|Ga0114968_10096917 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1809 | Open in IMG/M |
| 3300009172|Ga0114995_10570179 | Not Available | 618 | Open in IMG/M |
| 3300009339|Ga0117928_1153241 | Not Available | 745 | Open in IMG/M |
| 3300009425|Ga0114997_10119249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1590 | Open in IMG/M |
| 3300009425|Ga0114997_10297704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 894 | Open in IMG/M |
| 3300009438|Ga0115559_1249388 | Not Available | 630 | Open in IMG/M |
| 3300009443|Ga0115557_1362507 | Not Available | 538 | Open in IMG/M |
| 3300009472|Ga0115554_1180505 | Not Available | 863 | Open in IMG/M |
| 3300009481|Ga0114932_10221136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1148 | Open in IMG/M |
| 3300009481|Ga0114932_10384375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300009481|Ga0114932_10457004 | Not Available | 754 | Open in IMG/M |
| 3300009512|Ga0115003_10049236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2674 | Open in IMG/M |
| 3300009703|Ga0114933_10662912 | Not Available | 670 | Open in IMG/M |
| 3300009706|Ga0115002_11178781 | Not Available | 519 | Open in IMG/M |
| 3300009785|Ga0115001_10274781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1073 | Open in IMG/M |
| 3300009785|Ga0115001_10573627 | Not Available | 691 | Open in IMG/M |
| 3300009785|Ga0115001_10700865 | Not Available | 614 | Open in IMG/M |
| 3300009790|Ga0115012_10441257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1007 | Open in IMG/M |
| 3300010883|Ga0133547_11644746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1197 | Open in IMG/M |
| 3300011326|Ga0138403_1146031 | Not Available | 517 | Open in IMG/M |
| 3300011330|Ga0138383_1205037 | Not Available | 547 | Open in IMG/M |
| 3300012522|Ga0129326_1177121 | Not Available | 543 | Open in IMG/M |
| 3300012919|Ga0160422_11133333 | Not Available | 508 | Open in IMG/M |
| 3300012928|Ga0163110_10927292 | Not Available | 691 | Open in IMG/M |
| 3300012935|Ga0138257_1355919 | Not Available | 554 | Open in IMG/M |
| 3300012950|Ga0163108_10767784 | Not Available | 623 | Open in IMG/M |
| 3300012952|Ga0163180_11265231 | Not Available | 605 | Open in IMG/M |
| 3300012953|Ga0163179_10910091 | Not Available | 761 | Open in IMG/M |
| 3300012967|Ga0129343_1394520 | Not Available | 536 | Open in IMG/M |
| 3300019765|Ga0194024_1153469 | Not Available | 541 | Open in IMG/M |
| 3300020328|Ga0211567_1070070 | Not Available | 746 | Open in IMG/M |
| 3300020344|Ga0211570_1075368 | Not Available | 773 | Open in IMG/M |
| 3300020380|Ga0211498_10113470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1020 | Open in IMG/M |
| 3300020394|Ga0211497_10185668 | Not Available | 799 | Open in IMG/M |
| 3300020411|Ga0211587_10210913 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 811 | Open in IMG/M |
| 3300020425|Ga0211549_10117747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1028 | Open in IMG/M |
| 3300020425|Ga0211549_10146997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 922 | Open in IMG/M |
| 3300020442|Ga0211559_10159304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1074 | Open in IMG/M |
| 3300020443|Ga0211544_10381071 | Not Available | 564 | Open in IMG/M |
| 3300020447|Ga0211691_10460500 | Not Available | 517 | Open in IMG/M |
| 3300020462|Ga0211546_10044905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2162 | Open in IMG/M |
| 3300020478|Ga0211503_10567011 | Not Available | 594 | Open in IMG/M |
| 3300021065|Ga0206686_1159586 | Not Available | 659 | Open in IMG/M |
| 3300021084|Ga0206678_10499683 | Not Available | 560 | Open in IMG/M |
| 3300021089|Ga0206679_10303932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 866 | Open in IMG/M |
| 3300021791|Ga0226832_10239791 | Not Available | 722 | Open in IMG/M |
| 3300021963|Ga0222712_10120900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1803 | Open in IMG/M |
| 3300026087|Ga0208113_1121614 | Not Available | 585 | Open in IMG/M |
| 3300026091|Ga0207962_1078567 | Not Available | 633 | Open in IMG/M |
| 3300026192|Ga0207986_1067720 | Not Available | 820 | Open in IMG/M |
| 3300026199|Ga0208638_1108748 | Not Available | 786 | Open in IMG/M |
| 3300026207|Ga0208895_1161790 | Not Available | 579 | Open in IMG/M |
| 3300026321|Ga0208764_10273389 | Not Available | 819 | Open in IMG/M |
| 3300027287|Ga0255135_1038391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter → unclassified Candidatus Fonsibacter → Candidatus Fonsibacter sp. PEL3 | 581 | Open in IMG/M |
| 3300027301|Ga0255127_1078226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter → unclassified Candidatus Fonsibacter → Candidatus Fonsibacter sp. PEL3 | 517 | Open in IMG/M |
| 3300027335|Ga0255130_1021204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter → Candidatus Fonsibacter ubiquis | 1328 | Open in IMG/M |
| 3300027468|Ga0209247_1003140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter → Candidatus Fonsibacter ubiquis | 2122 | Open in IMG/M |
| 3300027589|Ga0255123_1021040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1367 | Open in IMG/M |
| 3300027755|Ga0209034_10195173 | Not Available | 626 | Open in IMG/M |
| 3300027760|Ga0209598_10313941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter → unclassified Candidatus Fonsibacter → Candidatus Fonsibacter sp. PEL3 | 609 | Open in IMG/M |
| 3300027838|Ga0209089_10703846 | Not Available | 518 | Open in IMG/M |
| 3300028190|Ga0257108_1198295 | Not Available | 570 | Open in IMG/M |
| 3300028488|Ga0257113_1232577 | Not Available | 528 | Open in IMG/M |
| 3300031599|Ga0308007_10110012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1006 | Open in IMG/M |
| 3300031757|Ga0315328_10747660 | Not Available | 550 | Open in IMG/M |
| 3300031773|Ga0315332_10176181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1390 | Open in IMG/M |
| 3300031773|Ga0315332_10868941 | Not Available | 543 | Open in IMG/M |
| 3300031775|Ga0315326_10923544 | Not Available | 537 | Open in IMG/M |
| 3300031886|Ga0315318_10670572 | Not Available | 584 | Open in IMG/M |
| 3300032032|Ga0315327_10167278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1375 | Open in IMG/M |
| 3300032278|Ga0310345_11680104 | Not Available | 620 | Open in IMG/M |
| 3300032360|Ga0315334_10321351 | Not Available | 1293 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.18% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 9.09% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 9.09% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.45% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 4.55% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.64% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.82% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.82% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 1.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.91% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.91% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.91% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.91% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.91% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.91% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573025 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-FOS-0p8-Hyp-75m | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001780 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Vondamm Supr46 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300005593 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 | Environmental | Open in IMG/M |
| 3300005948 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV | Environmental | Open in IMG/M |
| 3300005951 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
| 3300006323 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0500m | Environmental | Open in IMG/M |
| 3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300008249 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN10B Hudson Canyon | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009339 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011326 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011330 | Marine microbial communities from the Southern Atlantic ocean - KN S17 Surf_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012935 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020328 | Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX555937-ERR599015) | Environmental | Open in IMG/M |
| 3300020344 | Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX556104-ERR598987) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020425 | Marine microbial communities from Tara Oceans - TARA_B100001765 (ERX556083-ERR598964) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020443 | Marine microbial communities from Tara Oceans - TARA_B100001179 (ERX556000-ERR598944) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300026087 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026091 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026192 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 (SPAdes) | Environmental | Open in IMG/M |
| 3300026199 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026207 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV82 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027287 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300027301 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027335 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027755 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - 250m_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS310G0146KB_00252740 | 2189573025 | Marine Estuarine | IFIPKAFASLDLEMIQPSLLDKTTTGFLLILGLNNLSQET |
| JGI12421J11937_100574831 | 3300000756 | Freshwater And Sediment | PACFASVDLEIMHPSLLDKTTTGFLLKSGLNNLSQET* |
| supr46_10476531 | 3300001780 | Hydrothermal Vent Plume | IPRILASEDLEIIHPSLFDRTITGFLISEGLNNLSQDT* |
| GOS2246_101120504 | 3300001974 | Marine | PKFFASVDLDMTQPSLLESTITGFLFIDGLNNLSHET* |
| GOS24894_101325802 | 3300002033 | Marine | ALASVDLDITQPSLLDSTTTGFLIIDGLNNLSQET |
| GOS24894_103480701 | 3300002033 | Marine | ISLALSRDHPILIPRVFASLDLEIIQPSLLDKTTTGLFRILGLNNLSQET |
| GOS24894_104700321 | 3300002033 | Marine | ISLALSRDHPILIPRVFASLDLEIIQPSLLDKTTTGLFRILGLNNLSQET* |
| Ga0066837_102991032 | 3300005593 | Marine | LASVDREITHPSLLDNTITGFLIIDVLNNLSQET* |
| Ga0066380_100870861 | 3300005948 | Marine | SPILMPKALASVDREITHPSLLDNTTTGFLIIEGLNNLSHET* |
| Ga0066379_102498321 | 3300005951 | Marine | KILASIDREITQPSLLDNTMIGFLINEGLNNLSQET* |
| Ga0066382_102318032 | 3300006013 | Marine | YGSPILIPKALASIDREITQPSLFDSTITGFLIIDGLNNLSQET* |
| Ga0066375_101589091 | 3300006019 | Marine | LIPKTLASIDLVIIHPSLFDKTTTGFLIIDGLNNLSQET* |
| Ga0066836_101826734 | 3300006166 | Marine | FASIDLDITQPSLLERTITGFLFIDGLNNLSQET* |
| Ga0068472_103368421 | 3300006313 | Marine | ALASVDREITHPSLLDNTITGFLIMDGLKSLSQET* |
| Ga0068472_103761701 | 3300006313 | Marine | IYKALASADREITHPSLLDSTITGFLIIDGLNNLSQET* |
| Ga0068472_103796171 | 3300006313 | Marine | PKVLASVDREITHPSLFDNTTTGFLIIDGLNNLSQET* |
| Ga0068472_104757571 | 3300006313 | Marine | LDSFDREITHPSLLDSTMTGFLIIEGLNNLSQET* |
| Ga0068473_17354883 | 3300006316 | Marine | KTLASVEREIMHPSLYEKTTTGLLIIDGSNNLSQET* |
| Ga0068497_13319612 | 3300006323 | Marine | SPILMPKVLASVDREITPPSLLDNTITGFLIMDGLNNLSQET* |
| Ga0068488_12807024 | 3300006331 | Marine | PILIPRALASEDLEIIHPSLFDRTITGFLISEGLNNLSQDT* |
| Ga0068488_13243673 | 3300006331 | Marine | SPILIFKALASADREITHPSLFDNTMTGFLIIDGLNNLSQET* |
| Ga0068488_14349601 | 3300006331 | Marine | SPILIFKALASTDREITHPSLLDNTITGLLIIDGSNNLSQET* |
| Ga0068482_12588141 | 3300006338 | Marine | PKALASLDLEIIQPSLLDKTTTGLFLILGLNNLSQET* |
| Ga0100228_10891072 | 3300006565 | Marine | MPKAFASLALEIIQPSLLDKTTTGFFLIFGLNNLSQET* |
| Ga0066372_103486611 | 3300006902 | Marine | TLASVDREITHPSLLDNTTTGFLIIDGLNNLSQET* |
| Ga0066372_106512631 | 3300006902 | Marine | SPILMPKALASADREITQPSLLDNTTTGFLIIDGLNNLSQET* |
| Ga0102855_11954522 | 3300007647 | Estuarine | ILIPKAFASLDLEMIQPSLLDKTTTGFLLILGLNNLSQET* |
| Ga0102862_11198992 | 3300007670 | Estuarine | ILIPKAFASVDLEMIQPSLLDKTTTGFLLILGLNNLSQET* |
| Ga0105353_11259872 | 3300008249 | Methane Seep Mesocosm | LASVDREITHPSLLDNTTTGFLIIEGLNNLSHET* |
| Ga0105349_104553481 | 3300008253 | Methane Seep Mesocosm | PIFIPKALASLDLEIIQPSLLDKTTTGLFLILGLNNLSQET* |
| Ga0102911_11032313 | 3300009049 | Estuarine | ILIPKAFASLDLEIIQPSLLDKTITGFLLILGLNNLSQET* |
| Ga0102826_11315081 | 3300009054 | Estuarine | KAFASLDLEMIQPSLLDKTTTGFLLILGLNNLSQET* |
| Ga0102854_10302361 | 3300009058 | Estuarine | KAFASVDLEMIQPSLLDKTTTGFLLILGLNNLSQDT* |
| Ga0115552_12910102 | 3300009077 | Pelagic Marine | PKAFASLDLDIIQPSLLDKTTTGFLLILGLNNLSQET* |
| Ga0118730_11483171 | 3300009132 | Marine | ILIPKAFASLDLETIQPSLLDKTTTGFFLILGLNNLSQET* |
| Ga0102885_10100945 | 3300009142 | Estuarine | PILMPRAFASVDLAMMQPSLLDKTTTGLFLILGLNNLSQET* |
| Ga0114968_100969171 | 3300009155 | Freshwater Lake | IFIPSAFASSVLDTMQPSLLLNTTMGLFFKEGLNNLSQEA* |
| Ga0114995_105701791 | 3300009172 | Marine | RDFASFDLAIMQPSLLDNTTTGLFLILGLNNLSQET* |
| Ga0117928_11532411 | 3300009339 | Marine | KAFASLDLETIQPSLLDKTTTGFFLILGLNNLSQET* |
| Ga0114997_101192491 | 3300009425 | Marine | AFASVDLEMIQPSLLDKTTTGFLLILGLNNLSQET* |
| Ga0114997_102977043 | 3300009425 | Marine | IFFASVDLEIKHPSLLESTTTGLFIILGLKSLSQET* |
| Ga0115559_12493881 | 3300009438 | Pelagic Marine | ILIPKAFASFDLEMIQPSLLDKTTTGFLLILGLNNLSQET* |
| Ga0115557_13625071 | 3300009443 | Pelagic Marine | ILIPSAFASVDLAMIQPSLLDKTMTGLFLILGLNNLSQET* |
| Ga0115554_11805051 | 3300009472 | Pelagic Marine | PILIPKAFASLDLDIIQPSLLDKTTTGFLFILGLNNLSQDT* |
| Ga0114932_102211361 | 3300009481 | Deep Subsurface | KAFASLDLEMIQPSLLDRTTTGFILILGLNSLSQET* |
| Ga0114932_103843751 | 3300009481 | Deep Subsurface | ILIPSLFASVDLEITQPSLLDSTTTGLLLILGLNNLSQET* |
| Ga0114932_104570041 | 3300009481 | Deep Subsurface | KIFASVDLDITQPSLLERTTTGFLDIDGLNNLSQET* |
| Ga0115003_100492361 | 3300009512 | Marine | IPRALASFDLAIIQPSLFDKTITGLFLILGLNNLSQET* |
| Ga0114933_106629122 | 3300009703 | Deep Subsurface | FFASVDLDITHPSLLDSTTTGTFCILGLNNLSQDT* |
| Ga0114933_110117922 | 3300009703 | Deep Subsurface | FASVDLDIIHPSLFERTTTGFFIMCGLNNLSQDT* |
| Ga0115002_111787811 | 3300009706 | Marine | RALASFDLAMMHPSLLDKTTTGLFLILGLNNLSQET* |
| Ga0115001_102747813 | 3300009785 | Marine | GSPILMPIFFASTDLEITHPSLLESTTTGLFIILGLNNRSQET* |
| Ga0115001_105736272 | 3300009785 | Marine | SPILIPIFLASVDLEITHPSLLESTTTGLSIILGLNNRSQDT* |
| Ga0115001_107008651 | 3300009785 | Marine | IPRDFASFDLAIMQPSLLDNTITGLFLILGLNNLSQET* |
| Ga0115012_104412571 | 3300009790 | Marine | IFIPKVFASLDLEIIQPSLLDKTTTGLFIIFGLNNLSQET* |
| Ga0133547_116447461 | 3300010883 | Marine | AFASVDLAIMQPSLFDKTITGLFLILGLNNLSQET* |
| Ga0138403_11460312 | 3300011326 | Marine | FASLDLEIIQPSLLDKTTTGFFLILGLNNLSQDT* |
| Ga0138383_12050371 | 3300011330 | Marine | ILIPKAFASLDLEIIQPSLFDSTTTGFFLILGLNNLSHET* |
| Ga0129326_11771212 | 3300012522 | Aqueous | KAFASLDLEIIQPSLFDKTTTGFFLILGLNNLSHET* |
| Ga0160422_111333332 | 3300012919 | Seawater | GYPILIPNALASVDLDITQPSLFDSTTTGTFLILGLNNLSHET* |
| Ga0163110_109272921 | 3300012928 | Surface Seawater | ILIPKAFASLDLEMIQPSLLDKTTTGFLLILGLNNLSHET* |
| Ga0138257_13559192 | 3300012935 | Polar Marine | PIFIPRALASFDLAIIQPSLLDKTTTGLFLILGLNNLSQET* |
| Ga0163108_107677841 | 3300012950 | Seawater | FASLDLEIIQPSLLDKTTTGLFLIFGLNNLSQET* |
| Ga0163180_112652312 | 3300012952 | Seawater | PKAFASLDLEIIQPSLLDKTTTGFFLILGLNNLSQET* |
| Ga0163179_109100911 | 3300012953 | Seawater | AFASLDLEMIQPSLLDKTTTGFLFILGLNNLSHET* |
| Ga0129343_13945201 | 3300012967 | Aqueous | AFASLDLEMIQPSLFDKTTTGFFLILGLNNLSHET* |
| Ga0194024_11534691 | 3300019765 | Freshwater | MPIFFASEDLEITHPSLLDKTTTGRKLIFGLKSLSQET |
| Ga0211567_10700702 | 3300020328 | Marine | ALASVDREITHPSLLDNTITGFLIIDGLNNLSQET |
| Ga0211570_10753682 | 3300020344 | Marine | ALASVEREITHPSLFDNTITGFLIIEGLNNLSQET |
| Ga0211498_101134703 | 3300020380 | Marine | IAFASFDLDITQPSLFDKTTTGFFSILGLNNLSQET |
| Ga0211497_101856681 | 3300020394 | Marine | PIAFASFDLDITQPSLFDKTTTGFFSILGLNNLSQET |
| Ga0211623_103070682 | 3300020399 | Marine | IPRILASEDLEIIHPSLFDRTITGLFIREGLNNLSQET |
| Ga0211587_102109131 | 3300020411 | Marine | ALASLDRDTTQPSLLDNTMTGLLINLGLNTLSQDT |
| Ga0211549_101177471 | 3300020425 | Marine | SKTLASVEREITHPSLLDKTMTGFLIIDGLNNLSQET |
| Ga0211549_101469973 | 3300020425 | Marine | PILISKALASVDREIIHPSLLDSTTTGFLIMDGLNNLSQET |
| Ga0211559_101593041 | 3300020442 | Marine | FIPIAFASFDLDITQPSLFDKTTTGFFSILGLNNLSQET |
| Ga0211544_103810712 | 3300020443 | Marine | LIPKAFASVDREMTHPSLFDNTMTGFLIIEGSNNLSQET |
| Ga0211691_104605001 | 3300020447 | Marine | NVLASVDLDITQPSLLESTITGFLFIDGLNNLSQET |
| Ga0211546_100449051 | 3300020462 | Marine | LLASVDLDITHPSLLDKTTTGLFIIEGLNNLSQET |
| Ga0211503_105670112 | 3300020478 | Marine | IFIPKALASTDLDITQPSLLESTKTGFLVIEGLNNLSHET |
| Ga0206686_11595862 | 3300021065 | Seawater | KAFTSVDREITHPSLLDNTMTGFLIIDGSNNLSQET |
| Ga0206678_104996831 | 3300021084 | Seawater | ILMPKALASVDREITHPSLLDNTTTGFLIIEGLNNLSHET |
| Ga0206679_103039321 | 3300021089 | Seawater | KILASVDREITQPSLLDRTTTGFLFIDGLNNLSQET |
| Ga0226832_102397912 | 3300021791 | Hydrothermal Vent Fluids | MPKVLASVDREITHPSLLDNTTTGFLIIDGLNNLSQET |
| Ga0222712_101209001 | 3300021963 | Estuarine Water | TCFASVDLEIIQPSLLDKTTTGFLLKSGLNNLSQET |
| Ga0208113_11216141 | 3300026087 | Marine | LIPKILASVDREITHPSLLDSTITGFLIIDGLNNLSQET |
| Ga0207962_10785671 | 3300026091 | Marine | IFIPKIFASVDREITHPSLLDNTMTGFLIIEGLNNLSQET |
| Ga0207986_10677202 | 3300026192 | Marine | GSPILISRILASVDREITHPSLLDNTMTGFLIIKGLNNLSQET |
| Ga0208638_11087481 | 3300026199 | Marine | PILIPRVLASVDREITHPSLLDNTITGFLIIDVLNNLSQET |
| Ga0208895_11617901 | 3300026207 | Marine | PKTLASVEREMTHPSLFDNTTTGFFIIDGLNNLSHET |
| Ga0208764_102733892 | 3300026321 | Marine | YGSPIFIPKFLASVDLDITQPSLFDRTTTGFLSIDGLNNLSQET |
| Ga0255135_10383912 | 3300027287 | Freshwater | LIPACLASVDLEIIQPSLLDKTTTGFRLRSGLNNLSQET |
| Ga0255127_10782262 | 3300027301 | Freshwater | PTCFASVDLEIIQPSLLDKTTTGFRLRSGLNNLSQET |
| Ga0255130_10212044 | 3300027335 | Freshwater | LIPTCFASVDLEIIQPSLLDKTTTGFLLRSGLNNLSQET |
| Ga0209247_10031405 | 3300027468 | Freshwater Lake | PILMPACFASVDREIMHPSLLDKTTTGFLLKSGLNNLSQET |
| Ga0255123_10210401 | 3300027589 | Freshwater | PILIPACFASVDLEIIQPSLLDKTTTGFRLRSGLNNLSQET |
| Ga0209034_101951732 | 3300027755 | Marine | FIPKIFASTDLDITQPSLLERTTAGFLFIDGLNNLSQET |
| Ga0209598_103139411 | 3300027760 | Freshwater Lake | CFASVDREIMHPSLLDKTTTGFLLKSGLNNLSQET |
| Ga0209089_107038462 | 3300027838 | Marine | IALASVDRDITHPSLLDNTMTGFLIIDGLNNLSQET |
| Ga0257108_11982952 | 3300028190 | Marine | PILMPKALASVDREITHPSLLDNTTTGFLIIEGLNNLSHET |
| Ga0257113_12325772 | 3300028488 | Marine | ILMPKTLASIDREITHPSLLDNTTTGFLITDGLNNLSQET |
| Ga0308007_101100121 | 3300031599 | Marine | RALASFDLAMIQPSLLDKTTTGLFLILGLNNLSQET |
| Ga0315328_107476601 | 3300031757 | Seawater | IPKAFASIDLDITQPSLLESTTTGFLFIDGLNNLSQET |
| Ga0315332_101761814 | 3300031773 | Seawater | LMPKALASVDREITHPSLLDNTTTGFLIIEGLNNLSHET |
| Ga0315332_108689412 | 3300031773 | Seawater | PKFFASADLDITQPSLLERTTTGFLFIDGLNNLSQET |
| Ga0315326_109235442 | 3300031775 | Seawater | LKYGSPIFIPKFLASVDLDITQPSLFDRTTTGFLSIDGLNNLSQET |
| Ga0315318_106705721 | 3300031886 | Seawater | PKTLASVDRDITQPSLLDKTITGFLIIDGLNNLSQET |
| Ga0315327_101672781 | 3300032032 | Seawater | MPKILASVDREITQPSLLDRTITGFLVIEGLNNLSHET |
| Ga0310345_116801041 | 3300032278 | Seawater | SDLASVDLDITQPSLLERTTTGFFSIDGLNNLSQET |
| Ga0315334_103213514 | 3300032360 | Seawater | KLLASVDLDITQPSLFDRTITGFLSIDGLNNLSQET |
| ⦗Top⦘ |