


| Basic Information | |
|---|---|
| Family ID | F087698 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VEIDGTRVDDARRDMDLSKPAEFLLRAGKKKFLRVVVE |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.45 % |
| % of genes near scaffold ends (potentially truncated) | 92.73 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.79% Coil/Unstructured: 71.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01266 | DAO | 36.36 |
| PF01112 | Asparaginase_2 | 22.73 |
| PF02517 | Rce1-like | 6.36 |
| PF04519 | Bactofilin | 4.55 |
| PF00364 | Biotin_lipoyl | 1.82 |
| PF00083 | Sugar_tr | 1.82 |
| PF02195 | ParBc | 1.82 |
| PF13502 | AsmA_2 | 0.91 |
| PF00551 | Formyl_trans_N | 0.91 |
| PF13614 | AAA_31 | 0.91 |
| PF03950 | tRNA-synt_1c_C | 0.91 |
| PF00579 | tRNA-synt_1b | 0.91 |
| PF01479 | S4 | 0.91 |
| PF05164 | ZapA | 0.91 |
| PF00078 | RVT_1 | 0.91 |
| PF13401 | AAA_22 | 0.91 |
| PF10604 | Polyketide_cyc2 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 22.73 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 6.36 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 6.36 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 4.55 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG3027 | Cell division protein ZapA, inhibits GTPase activity of FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.27 % |
| Unclassified | root | N/A | 12.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10127580 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300001356|JGI12269J14319_10051673 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300002907|JGI25613J43889_10141194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300004091|Ga0062387_100075868 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300004635|Ga0062388_102962855 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005171|Ga0066677_10842848 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005518|Ga0070699_101023093 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005537|Ga0070730_10084533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2218 | Open in IMG/M |
| 3300005764|Ga0066903_101873216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1148 | Open in IMG/M |
| 3300005921|Ga0070766_10461580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 840 | Open in IMG/M |
| 3300005944|Ga0066788_10028996 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300006050|Ga0075028_100506195 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300006172|Ga0075018_10267235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300006175|Ga0070712_101652194 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006755|Ga0079222_10166701 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300007788|Ga0099795_10596471 | Not Available | 525 | Open in IMG/M |
| 3300009088|Ga0099830_10293134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
| 3300009101|Ga0105247_10473267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300009137|Ga0066709_103474365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300009700|Ga0116217_10982232 | Not Available | 517 | Open in IMG/M |
| 3300010358|Ga0126370_11980852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300010362|Ga0126377_10147296 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300010362|Ga0126377_13068026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300011270|Ga0137391_11354038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012285|Ga0137370_10616670 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012683|Ga0137398_10109145 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300012683|Ga0137398_10230452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300012929|Ga0137404_10633192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300012931|Ga0153915_11932764 | Not Available | 690 | Open in IMG/M |
| 3300012931|Ga0153915_12679542 | Not Available | 583 | Open in IMG/M |
| 3300012964|Ga0153916_10927100 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300013306|Ga0163162_12509459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300013308|Ga0157375_11268803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300013832|Ga0120132_1009396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
| 3300015051|Ga0137414_1042208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300015053|Ga0137405_1414691 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300015242|Ga0137412_10572913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300016294|Ga0182041_11546922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300016294|Ga0182041_12128732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300017924|Ga0187820_1298541 | Not Available | 530 | Open in IMG/M |
| 3300017961|Ga0187778_10971699 | Not Available | 587 | Open in IMG/M |
| 3300017975|Ga0187782_11314313 | Not Available | 567 | Open in IMG/M |
| 3300018058|Ga0187766_10084049 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300018062|Ga0187784_10104530 | Not Available | 2305 | Open in IMG/M |
| 3300018085|Ga0187772_11244281 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300018086|Ga0187769_10019161 | All Organisms → cellular organisms → Bacteria | 4517 | Open in IMG/M |
| 3300018086|Ga0187769_11182981 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300020579|Ga0210407_11252246 | Not Available | 556 | Open in IMG/M |
| 3300021168|Ga0210406_10215854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1586 | Open in IMG/M |
| 3300021170|Ga0210400_10089849 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
| 3300021181|Ga0210388_11814392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300021402|Ga0210385_10857332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300021420|Ga0210394_10086937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2700 | Open in IMG/M |
| 3300021479|Ga0210410_11200915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300021559|Ga0210409_10038120 | All Organisms → cellular organisms → Bacteria | 4572 | Open in IMG/M |
| 3300021559|Ga0210409_10684162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300021559|Ga0210409_11489755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300024284|Ga0247671_1022841 | Not Available | 940 | Open in IMG/M |
| 3300025899|Ga0207642_10760059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300027174|Ga0207948_1001125 | All Organisms → cellular organisms → Bacteria | 2844 | Open in IMG/M |
| 3300027330|Ga0207777_1014207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1610 | Open in IMG/M |
| 3300027651|Ga0209217_1045717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1332 | Open in IMG/M |
| 3300027681|Ga0208991_1156981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300027738|Ga0208989_10195178 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300027787|Ga0209074_10055090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300027846|Ga0209180_10630109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300027905|Ga0209415_10022690 | All Organisms → cellular organisms → Bacteria | 9562 | Open in IMG/M |
| 3300027910|Ga0209583_10179249 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300028381|Ga0268264_10456559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300028759|Ga0302224_10077143 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300028773|Ga0302234_10168979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300028879|Ga0302229_10085885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1505 | Open in IMG/M |
| 3300029636|Ga0222749_10000578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22033 | Open in IMG/M |
| 3300029910|Ga0311369_10027468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6602 | Open in IMG/M |
| 3300030013|Ga0302178_10244415 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300030520|Ga0311372_12703859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300031057|Ga0170834_108547189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300031236|Ga0302324_100223827 | Not Available | 2970 | Open in IMG/M |
| 3300031236|Ga0302324_103381834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300031572|Ga0318515_10417469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300031679|Ga0318561_10079577 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300031680|Ga0318574_10168870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300031680|Ga0318574_10896304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031718|Ga0307474_10339965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300031718|Ga0307474_10611856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300031719|Ga0306917_11376422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300031744|Ga0306918_10894581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300031754|Ga0307475_10857239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300031768|Ga0318509_10199161 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300031768|Ga0318509_10247903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300031769|Ga0318526_10396962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300031782|Ga0318552_10101503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
| 3300031833|Ga0310917_10276830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300031879|Ga0306919_11514516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300031910|Ga0306923_11639953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300031942|Ga0310916_10490471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300031954|Ga0306926_10118357 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
| 3300032051|Ga0318532_10297649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300032059|Ga0318533_10154111 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300032059|Ga0318533_10185555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1484 | Open in IMG/M |
| 3300032068|Ga0318553_10065029 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300032174|Ga0307470_10214777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1241 | Open in IMG/M |
| 3300032515|Ga0348332_10727452 | Not Available | 602 | Open in IMG/M |
| 3300032783|Ga0335079_11665634 | Not Available | 625 | Open in IMG/M |
| 3300032828|Ga0335080_10714909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300032829|Ga0335070_11720589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300032829|Ga0335070_12127853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300032892|Ga0335081_10439879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1662 | Open in IMG/M |
| 3300033134|Ga0335073_11540098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300033158|Ga0335077_10311622 | Not Available | 1719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.36% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.73% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101275801 | 3300000567 | Peatlands Soil | VEVDEARVSDVKKEIDLATPREFLLRAGKKKFLRVVVE* |
| JGI12269J14319_100516732 | 3300001356 | Peatlands Soil | LEIDGVRVDDVKREIDLSKPADFLLRAGKKKFLRLIVE* |
| JGI25613J43889_101411942 | 3300002907 | Grasslands Soil | LIKQKAVEIDGVTIDDPRKDIDLSKPTEFLLRAGKKKFLRIVVE* |
| Ga0062387_1000758683 | 3300004091 | Bog Forest Soil | EQGGVEIDGVRVEDVRKDIDLSKPSEFLLRVGKKKFLRIIIE* |
| Ga0062388_1029628552 | 3300004635 | Bog Forest Soil | KQRGVEIDGVAAEDPRQDVELSQPREFLLRAGKKKFLRIIVE* |
| Ga0066677_108428481 | 3300005171 | Soil | KQKGVEINETAVDDFRKELDLSRPAEFLIRAGKKKFLRLVVE* |
| Ga0070699_1010230931 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGIEINEQRVDDVRKVIDLSQPGEFLLRAGKKKFLRIIVE* |
| Ga0070730_100845331 | 3300005537 | Surface Soil | VEIDGVRVDDPRKDIDLSKPAEFLLRAGKKKFLRIIIE* |
| Ga0066903_1018732162 | 3300005764 | Tropical Forest Soil | KQKAVEIDGVIIEDPRKDIDLSKPAIFLVRAGKKRFLRVVVE* |
| Ga0070766_104615801 | 3300005921 | Soil | EGVTIEDPRKDVDLGKPSEFLLRAGKKKFVRVVVE* |
| Ga0066788_100289963 | 3300005944 | Soil | VEIDGTRVDDARRDMDLSKPAEFLLRAGKKKFLRVVVE* |
| Ga0075028_1005061951 | 3300006050 | Watersheds | VKQRAVELDGEIVDDPSTVIDLSKPREFLLRSGKKKFVRVVLVEG* |
| Ga0075018_102672351 | 3300006172 | Watersheds | IDGVRIDDPRKDIDLSKPVEFLLRAGKKKFVRIVVE* |
| Ga0070712_1016521941 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EIDGQRVNDFRKDVDLTGPADFLLRAGKKKFLRIVVE* |
| Ga0079222_101667011 | 3300006755 | Agricultural Soil | QKGVEIDGSIVEDFRKEIDLSQPREFLLRAGKKKFLRLIVE* |
| Ga0099795_105964711 | 3300007788 | Vadose Zone Soil | QGGVEINEQRVEDFRKDVDLSQAGEFLLRAGKKKFLRIIVE* |
| Ga0099830_102931341 | 3300009088 | Vadose Zone Soil | GARADDPRKDIDLSKPADFLLRAGKKKFVRIVVE* |
| Ga0105247_104732671 | 3300009101 | Switchgrass Rhizosphere | QGGVEINGQRVDNFRKDVDLTTSCEFLLRAGKKKFLRIVVE* |
| Ga0066709_1034743652 | 3300009137 | Grasslands Soil | VELNETPVEDFRKELDLSKPAEFLIRAGKKKFLRLVVE* |
| Ga0116217_109822321 | 3300009700 | Peatlands Soil | NGHRVDDVKHEIDLSKPGEFLLRAGKKKFLRIVVE* |
| Ga0126370_119808522 | 3300010358 | Tropical Forest Soil | ERLIKQKAVEIDAVMIEDWRKDIDLSKPTNFLLRAGKKKFVRVVVE* |
| Ga0126377_101472963 | 3300010362 | Tropical Forest Soil | LIKQGGVEINESRIDDFRKDIDFSKPSEFLLRAGKKKFLRIVVE* |
| Ga0126377_130680261 | 3300010362 | Tropical Forest Soil | GGVEINEQRVDDFRKDVDLSQPAEFLLRAGKKKFLRLVVE* |
| Ga0137391_113540381 | 3300011270 | Vadose Zone Soil | NEQRVDDFRKDIDLTQPQEFLLRAGKKKFLRIVVE* |
| Ga0137370_106166702 | 3300012285 | Vadose Zone Soil | VELDGERVSEVNREVDLTRPRDFLLRAGKKKFLRIVVE* |
| Ga0137398_101091451 | 3300012683 | Vadose Zone Soil | IDGVTIDDPRKDIDLSKPTEFLLRAGKKKFLRIVVE* |
| Ga0137398_102304521 | 3300012683 | Vadose Zone Soil | KAVEIDGVTIDDPRKDIDLSKPTEFLLRAGKKKFLRIVVE* |
| Ga0137404_106331921 | 3300012929 | Vadose Zone Soil | IDGVRIDDPRKDIDLSKPVEFLLRAGKKKFVRVVVE* |
| Ga0153915_119327641 | 3300012931 | Freshwater Wetlands | IKQGGVELDGARVDDVRKEVDLTQPGAFLLRAGKKKFLRLVVE* |
| Ga0153915_126795421 | 3300012931 | Freshwater Wetlands | GQRVDDVKREIDLSKPGEFLLRAGKKKFLRVVIE* |
| Ga0153916_109271001 | 3300012964 | Freshwater Wetlands | VELDGARVDDVRKEVDLAQPGVFLLRAGKKKFLRLVVE* |
| Ga0163162_125094591 | 3300013306 | Switchgrass Rhizosphere | KQGGVEINGRRVDNFRKDVDLTTSCEFLLRAGKKKFLRIVVE* |
| Ga0157375_112688032 | 3300013308 | Miscanthus Rhizosphere | GVEIDGERVVDVKKELAFSAPVEFLLRAGKKKFIRVVVE* |
| Ga0120132_10093961 | 3300013832 | Permafrost | AVEIDGQRIDDPRKEIDLSKPNNFLLRAGKKKFLRIVIA* |
| Ga0137414_10422081 | 3300015051 | Vadose Zone Soil | DEARVDDPRRDIDLSKPAEFLLRAGKKKFLRVVVE* |
| Ga0137405_14146916 | 3300015053 | Vadose Zone Soil | VEINETPVEDFRKELDLSKPAEFLIRAGKKKFLRLVVE* |
| Ga0137412_105729132 | 3300015242 | Vadose Zone Soil | DEARVDDPRRDIDLSKPAEFLLRAGKKKFLRVIVE* |
| Ga0182041_115469222 | 3300016294 | Soil | DGARVNDFRKEIDLTRTGEFLLRAGKKKFLRIVVQ |
| Ga0182041_121287321 | 3300016294 | Soil | EAERPIKQRGVEINEACVEDARKEIDLSKPREFLLRAGKKRFVRVVVE |
| Ga0187820_12985412 | 3300017924 | Freshwater Sediment | NGQRVDDFRRDIDLTQPIEFLLRAGKKKFLRIIVE |
| Ga0187778_109716992 | 3300017961 | Tropical Peatland | VEIDGVRVDDVKREIDLSRPYQYLLRVGKKKFLRLVVG |
| Ga0187782_113143132 | 3300017975 | Tropical Peatland | LIKLVGVEIDGVRVDDVKREIDLSKPGEYLVRAGKKKFLRLVVAESAR |
| Ga0187766_100840494 | 3300018058 | Tropical Peatland | EIDGVRVDDVKREIDLSKPGEYLLRAGKKKFLRLVVA |
| Ga0187784_101045303 | 3300018062 | Tropical Peatland | MACEGGPRPQNGVEIDGARVEDARSELDLSRAGSYLLRAGKKKFLRLVVE |
| Ga0187772_112442811 | 3300018085 | Tropical Peatland | NGVEIDGARVEDARSELDLSRAGSYLLRAGKKKFLRLVVE |
| Ga0187769_100191611 | 3300018086 | Tropical Peatland | IDGVRMDDVKRELDLSRPYQYLLRVGKKKFLRLTVE |
| Ga0187769_111829812 | 3300018086 | Tropical Peatland | VEIDGARVEDVRGELDLSRAGSYLLRAGKKKFLRL |
| Ga0210407_112522461 | 3300020579 | Soil | LVKQGAVELNESRIDDPRKDIDLSKPTQLLLRAGKKKFLRLIVE |
| Ga0210406_102158541 | 3300021168 | Soil | KSVEIDGVTIDDPRKDIDLSKSSEFLLRAGKKKFVRVVVE |
| Ga0210400_100898491 | 3300021170 | Soil | QGAVELNESRVDDPRADLDLTKPVQFLLRAGKKKFLRLIVE |
| Ga0210388_118143921 | 3300021181 | Soil | EIDGARVSDVKFDLDLSRPSAFLLRAGKKKFLRIVVE |
| Ga0210385_108573321 | 3300021402 | Soil | QGGVEIDGARVDDARKEIDMSKPREFLLRVGKKKFVRVVMA |
| Ga0210394_100869371 | 3300021420 | Soil | ELDGARVSDVKHEVDLTKPREILLRAGKKKFLRIRVE |
| Ga0210410_112009151 | 3300021479 | Soil | HKGVEIDGLLAEDPRQDIDLSQPREFLLRVGKKKFVRIIVE |
| Ga0210409_100381206 | 3300021559 | Soil | DGQRIDDPRKEVDLSKGRNFLLRAGKKKFVRLVVE |
| Ga0210409_106841623 | 3300021559 | Soil | VELNESRVDDPRADLDLTKPAQFLLRAGKKKFLRLIVE |
| Ga0210409_114897552 | 3300021559 | Soil | QGGVEIDGARVDDPRRDVDLGKSREFLLRVGKKKFFRIVVE |
| Ga0247671_10228412 | 3300024284 | Soil | VEINEQRVDDFRREVDLTQADEFLLRAGKKKFLRVVVE |
| Ga0207642_107600592 | 3300025899 | Miscanthus Rhizosphere | VEIDGQRVDDFRKDVDLTGPADFLLRAGKKKFLRIVVE |
| Ga0207948_10011251 | 3300027174 | Forest Soil | DGVPVDDPRKDFDLRNAGEFLLRAGKKKFLRIVVE |
| Ga0207777_10142071 | 3300027330 | Tropical Forest Soil | ERLIKQRGVEIDETCVEDVRKEIDLSKPGEFLLRAGKKKFLRVVVE |
| Ga0209217_10457171 | 3300027651 | Forest Soil | IKQKAVEIDGVTIEDPRKEIDLSNPCEFLLRAGKKKFLRIVVD |
| Ga0208991_11569811 | 3300027681 | Forest Soil | VEIDGERVSDVKMEVDLARPRELLLRAGKKKFLRLVIE |
| Ga0208989_101951781 | 3300027738 | Forest Soil | GVEIDGERVSDVKMEVDLARPREYLLRAGKKKFLRLVIE |
| Ga0209074_100550902 | 3300027787 | Agricultural Soil | QKGVEIDGSIVEDFRKEIDLSQPREFLLRAGKKKFLRLIVE |
| Ga0209180_106301091 | 3300027846 | Vadose Zone Soil | DGARVDDFRRDVDLSKPVEFLLRAGKKKFLRIVVE |
| Ga0209415_1002269011 | 3300027905 | Peatlands Soil | LEIDGVRVDDVKREIDLSKPADFLLRAGKKKFLRLIVE |
| Ga0209583_101792491 | 3300027910 | Watersheds | QKGVEINEAPVEDFRKELDLTQPGEYLIRAGKKKFLRVVVE |
| Ga0268264_104565591 | 3300028381 | Switchgrass Rhizosphere | GVEINEQRVDDFRKDVDLTEGCEFLLRAGKKKFLRIVVE |
| Ga0302224_100771432 | 3300028759 | Palsa | DGVRVSDVKKEMDVSQPGGFLLRAGKKKFLRVVVE |
| Ga0302234_101689791 | 3300028773 | Palsa | VEIDGVPAEDPRQEIELREPREFLLRAGKKRFLRIVVE |
| Ga0302229_100858853 | 3300028879 | Palsa | GGVEVDGVRVSDVKKEMDVSQPGGFLLRAGKKKFLRVVVE |
| Ga0222749_100005781 | 3300029636 | Soil | MKQGGVEIEGRREDDVKREIDLSKPGEFLLRAGKKKFLRIVVE |
| Ga0311369_100274687 | 3300029910 | Palsa | VEVDGVRVSDVKKEMDVSQPGGFLLRAGKKKFLRVVVE |
| Ga0302178_102444151 | 3300030013 | Palsa | LIKQGGVEIDGVPAEDPRQEIELREPREFLLRAGKKRFLRIVVE |
| Ga0311372_127038591 | 3300030520 | Palsa | GVELDGQRVEDVKRDIELSKPAEFLLRAGKKKFLRIVVE |
| Ga0170834_1085471891 | 3300031057 | Forest Soil | IDGARVDDARKEIDMSRPREFLLRAGKKKFVRVVVA |
| Ga0302324_1002238271 | 3300031236 | Palsa | VEIAGQRVDDVKRDVDLSKPGEFLLRAGKKKFLRIVVE |
| Ga0302324_1033818342 | 3300031236 | Palsa | QGGVEVGGTRVDDVQKQIDLSKPSEFLLRAGKKKFVRVVVE |
| Ga0318515_104174692 | 3300031572 | Soil | IDGLAVDDPRKEMDLTKPYEFLLRAGKKKFVRIIVE |
| Ga0318561_100795773 | 3300031679 | Soil | DGACVEDARMEIDLSKPREFLLRAGKKKFVRVVVE |
| Ga0318574_101688701 | 3300031680 | Soil | KQKAVEIDGLAVDDPRKEMDLTKPYEFLLRAGKKKFVRIIVE |
| Ga0318574_108963041 | 3300031680 | Soil | VEINEACVEDARKEIDLSKPREFLLRVGKKKFVRVVVE |
| Ga0307474_103399651 | 3300031718 | Hardwood Forest Soil | KQKAVEIDGVTIDDSRKDIDLSKPCEFLLRAGKKKFVRVIIE |
| Ga0307474_106118562 | 3300031718 | Hardwood Forest Soil | LVKQKGVEIDGVLAEDPRQDIDLSQPREFLLRAGKKKFLRIIVE |
| Ga0306917_113764222 | 3300031719 | Soil | GGAEIDGQRVEDFRKDVDLTQPKEFLLRAGKKKFLRVVVE |
| Ga0306918_108945812 | 3300031744 | Soil | KQRGVEIDETCVEDVRKEIDLSKPGEFLLRAGKKKFLRVVVE |
| Ga0307475_108572391 | 3300031754 | Hardwood Forest Soil | EINGERADVKKEVDLSKSGEFLVRAGKKKFMRIVVE |
| Ga0318509_101991611 | 3300031768 | Soil | EINEACVEDPRTEIDLSKPAEFLLRAGKKKFVRVVVE |
| Ga0318509_102479031 | 3300031768 | Soil | INEACVEDARKEIDLSEPREFLLRVGKKKFVRVVVE |
| Ga0318526_103969621 | 3300031769 | Soil | IDSERVDDFRKDIDLTQSGEFLLRAGKKKFLRVVVE |
| Ga0318552_101015031 | 3300031782 | Soil | RLIKQRGVEINEACVEDARKEIDLSEPREFLLRAGKKKFVRVVVE |
| Ga0310917_102768301 | 3300031833 | Soil | ERLIKQRGVEIDEICVEDPRKEIDLSKPGQFLLRAGKKKFLRMIIE |
| Ga0306919_115145161 | 3300031879 | Soil | QGGVEIDSVSVEDPRKVVDLSKSREFLLRAGKKKFVRVVVD |
| Ga0306923_116399531 | 3300031910 | Soil | HGGVEIDQSRVDDPRMDIDLSRPSQLLVRAGKKKFLRVIVE |
| Ga0310916_104904712 | 3300031942 | Soil | NEACVEDARKEIDLSEPGEFLLRAGKKKFVRVVVE |
| Ga0306926_101183574 | 3300031954 | Soil | AERLVKQRGVEIDETCVEDVRKEIDLSKPGEFLLRAGKKKFLRVVVE |
| Ga0318532_102976492 | 3300032051 | Soil | KQGGAEIDGQRVEDFRKDVDLTQPKEFLLRAGKKKFLRVVVE |
| Ga0318533_101541113 | 3300032059 | Soil | VEIDGACVEDARMEIDLSKPREFLLRAGKKKFVRVVVE |
| Ga0318533_101855551 | 3300032059 | Soil | LVKQRGVEIDETCVEDVRKEIDLSKPGEFLLRAGKKKFLRVVVE |
| Ga0318553_100650293 | 3300032068 | Soil | KQRGVEINEACVEDARKEIDLSEPGEFLLRAGKKKFVRVVVE |
| Ga0307470_102147772 | 3300032174 | Hardwood Forest Soil | GLEIDGARVDDPRKDVDLSKPGEFLLRAGKKKFVRVIVG |
| Ga0348332_107274521 | 3300032515 | Plant Litter | DGQRVVDVTREIDLSTAGEFLIRAGKKKFLRVIVE |
| Ga0335079_116656341 | 3300032783 | Soil | AGQRIDDVKREVDLSRPSEFLLRAGKKKFLRVVVE |
| Ga0335080_107149091 | 3300032828 | Soil | IDGTTVEDPRKEIDLDKPQEFLLRAGKKKFLRVIVE |
| Ga0335070_117205892 | 3300032829 | Soil | KQRGVEIDEACVEDPRKEIDLSNPVQFLLRAGKKKFVRVVVE |
| Ga0335070_121278532 | 3300032829 | Soil | KGIELNESPVEDFRKELDLSQPAEYLIRAGKKKFLRLIVE |
| Ga0335081_104398793 | 3300032892 | Soil | GVEIDEVCVEDPREKIDLSHPMQFLLRAGKKKFVRVVVE |
| Ga0335073_115400982 | 3300033134 | Soil | KQGGVELDEVRVDDVRKDVDLSVPKEFLLRAGKKKFVKIVVE |
| Ga0335077_103116223 | 3300033158 | Soil | GGVEIEGARVDDARSELDLSRPGSYLLRAGKKKFLRLVIE |
| ⦗Top⦘ |