


| Basic Information | |
|---|---|
| Family ID | F087684 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | NQTFEYAASRGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.82 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (42.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 17.14% Coil/Unstructured: 78.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF04828 | GFA | 17.27 |
| PF03739 | LptF_LptG | 11.82 |
| PF05299 | Peptidase_M61 | 1.82 |
| PF08002 | DUF1697 | 0.91 |
| PF00133 | tRNA-synt_1 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 17.27 |
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 11.82 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 1.82 |
| COG3975 | Predicted metalloprotease, contains C-terminal PDZ domain | General function prediction only [R] | 1.82 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004101|Ga0058896_1420629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 927 | Open in IMG/M |
| 3300005363|Ga0008090_14903408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 697 | Open in IMG/M |
| 3300005363|Ga0008090_15148570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1030 | Open in IMG/M |
| 3300005557|Ga0066704_10253076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1196 | Open in IMG/M |
| 3300005764|Ga0066903_101719563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1195 | Open in IMG/M |
| 3300006172|Ga0075018_10735065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300006176|Ga0070765_101680430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 596 | Open in IMG/M |
| 3300006797|Ga0066659_10587605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 903 | Open in IMG/M |
| 3300009137|Ga0066709_101138229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1148 | Open in IMG/M |
| 3300010046|Ga0126384_11537228 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010303|Ga0134082_10034812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1903 | Open in IMG/M |
| 3300010360|Ga0126372_12819495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 538 | Open in IMG/M |
| 3300010371|Ga0134125_10962760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 936 | Open in IMG/M |
| 3300010373|Ga0134128_10880723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 991 | Open in IMG/M |
| 3300010376|Ga0126381_100292084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2228 | Open in IMG/M |
| 3300010376|Ga0126381_100723505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1425 | Open in IMG/M |
| 3300011120|Ga0150983_15061358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1038 | Open in IMG/M |
| 3300011120|Ga0150983_16696518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1100 | Open in IMG/M |
| 3300012203|Ga0137399_10757552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 817 | Open in IMG/M |
| 3300012362|Ga0137361_10567269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1041 | Open in IMG/M |
| 3300012927|Ga0137416_10301726 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300012971|Ga0126369_12741012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 576 | Open in IMG/M |
| 3300012977|Ga0134087_10096267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1234 | Open in IMG/M |
| 3300012989|Ga0164305_11666317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300014150|Ga0134081_10039657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1386 | Open in IMG/M |
| 3300015052|Ga0137411_1212625 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300015054|Ga0137420_1090689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 906 | Open in IMG/M |
| 3300015356|Ga0134073_10001643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4406 | Open in IMG/M |
| 3300016371|Ga0182034_10485153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1028 | Open in IMG/M |
| 3300017930|Ga0187825_10082543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1104 | Open in IMG/M |
| 3300017959|Ga0187779_10165020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1372 | Open in IMG/M |
| 3300017974|Ga0187777_10282788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1131 | Open in IMG/M |
| 3300018062|Ga0187784_10370840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1159 | Open in IMG/M |
| 3300018085|Ga0187772_10908706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 640 | Open in IMG/M |
| 3300018482|Ga0066669_10463554 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300019786|Ga0182025_1354236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1162 | Open in IMG/M |
| 3300020199|Ga0179592_10025449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2652 | Open in IMG/M |
| 3300021171|Ga0210405_10995878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 632 | Open in IMG/M |
| 3300021178|Ga0210408_10253170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300021180|Ga0210396_11470714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 561 | Open in IMG/M |
| 3300021307|Ga0179585_1042184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 906 | Open in IMG/M |
| 3300021377|Ga0213874_10069017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1123 | Open in IMG/M |
| 3300021403|Ga0210397_11495926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 524 | Open in IMG/M |
| 3300021420|Ga0210394_10885248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 777 | Open in IMG/M |
| 3300021433|Ga0210391_11583051 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300021559|Ga0210409_10073525 | All Organisms → cellular organisms → Bacteria | 3175 | Open in IMG/M |
| 3300022504|Ga0242642_1033023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 755 | Open in IMG/M |
| 3300022504|Ga0242642_1092873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 520 | Open in IMG/M |
| 3300022507|Ga0222729_1030707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 680 | Open in IMG/M |
| 3300022533|Ga0242662_10213893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
| 3300022718|Ga0242675_1057462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 667 | Open in IMG/M |
| 3300022724|Ga0242665_10125324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 788 | Open in IMG/M |
| 3300024330|Ga0137417_1313367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2595 | Open in IMG/M |
| 3300025906|Ga0207699_10086329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1959 | Open in IMG/M |
| 3300025928|Ga0207700_11443154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 611 | Open in IMG/M |
| 3300026310|Ga0209239_1107193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1177 | Open in IMG/M |
| 3300026310|Ga0209239_1231192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 643 | Open in IMG/M |
| 3300026540|Ga0209376_1045586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2570 | Open in IMG/M |
| 3300026547|Ga0209156_10080358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1653 | Open in IMG/M |
| 3300026550|Ga0209474_10167019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1423 | Open in IMG/M |
| 3300026675|Ga0208068_101161 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027616|Ga0209106_1095512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 667 | Open in IMG/M |
| 3300027829|Ga0209773_10247270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 745 | Open in IMG/M |
| 3300028906|Ga0308309_11549129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 565 | Open in IMG/M |
| 3300030531|Ga0210274_1076403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 688 | Open in IMG/M |
| 3300030581|Ga0210270_1712666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1061 | Open in IMG/M |
| 3300030991|Ga0073994_12420941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 871 | Open in IMG/M |
| 3300031057|Ga0170834_100198100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1150 | Open in IMG/M |
| 3300031231|Ga0170824_102713730 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300031543|Ga0318516_10707900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 571 | Open in IMG/M |
| 3300031545|Ga0318541_10269301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300031549|Ga0318571_10047574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1266 | Open in IMG/M |
| 3300031549|Ga0318571_10259950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300031564|Ga0318573_10025950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2693 | Open in IMG/M |
| 3300031564|Ga0318573_10208357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1037 | Open in IMG/M |
| 3300031572|Ga0318515_10021392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3059 | Open in IMG/M |
| 3300031681|Ga0318572_10680765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
| 3300031681|Ga0318572_10920381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 519 | Open in IMG/M |
| 3300031715|Ga0307476_11278615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 536 | Open in IMG/M |
| 3300031723|Ga0318493_10478114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300031736|Ga0318501_10333369 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300031736|Ga0318501_10690824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300031740|Ga0307468_101043208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 723 | Open in IMG/M |
| 3300031747|Ga0318502_10964215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 519 | Open in IMG/M |
| 3300031748|Ga0318492_10437866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300031751|Ga0318494_10076476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1812 | Open in IMG/M |
| 3300031753|Ga0307477_10349974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1016 | Open in IMG/M |
| 3300031770|Ga0318521_10603636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300031781|Ga0318547_10350638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 901 | Open in IMG/M |
| 3300031805|Ga0318497_10078106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
| 3300031820|Ga0307473_11194524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300031833|Ga0310917_11204105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 504 | Open in IMG/M |
| 3300031845|Ga0318511_10068198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
| 3300031894|Ga0318522_10055628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1406 | Open in IMG/M |
| 3300031910|Ga0306923_10379879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1609 | Open in IMG/M |
| 3300031910|Ga0306923_10628590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1202 | Open in IMG/M |
| 3300031945|Ga0310913_10903239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300031947|Ga0310909_10984207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 689 | Open in IMG/M |
| 3300032008|Ga0318562_10275327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 978 | Open in IMG/M |
| 3300032051|Ga0318532_10146450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 838 | Open in IMG/M |
| 3300032054|Ga0318570_10254486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300032059|Ga0318533_10584847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300032068|Ga0318553_10256243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300032068|Ga0318553_10701259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300032076|Ga0306924_11767532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 646 | Open in IMG/M |
| 3300032089|Ga0318525_10270268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300032089|Ga0318525_10295676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 832 | Open in IMG/M |
| 3300032805|Ga0335078_11962159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 628 | Open in IMG/M |
| 3300032955|Ga0335076_11260186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 624 | Open in IMG/M |
| 3300033158|Ga0335077_10177131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2419 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 42.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026675 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN344 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030531 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030581 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058896_14206292 | 3300004101 | Forest Soil | EVVGHDLENQTFEYAASTGDGYWVRHFMLDNPTGADCIYCRLFPGHRHH* |
| Ga0008090_149034081 | 3300005363 | Tropical Rainforest Soil | HDLENQTFEHAASRGDGYWVRHFMLDNPTGADCIYCRLFPGQHPH* |
| Ga0008090_151485701 | 3300005363 | Tropical Rainforest Soil | GHDLQNQSFEHAASRGDGYWVRHFMLDNPTGADCIYCRLFPGHKH* |
| Ga0066704_102530761 | 3300005557 | Soil | EVVGHDLENQTFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPTQQHEH* |
| Ga0066903_1017195631 | 3300005764 | Tropical Forest Soil | SRGEGYWVRHFVPDNPTGADCIYCRLFPAHRHSH* |
| Ga0075018_107350651 | 3300006172 | Watersheds | LQHHSFEHAASRSDGYWVRHFMPENPTGADCIYCRLFPGHAH* |
| Ga0070765_1016804301 | 3300006176 | Soil | AAARGEGYWVRHFMLDNPTGADCIYCRLFPGHKH* |
| Ga0066659_105876051 | 3300006797 | Soil | ENQTFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPTQQHKH* |
| Ga0066709_1011382292 | 3300009137 | Grasslands Soil | GHDLENQTFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPTQQHEH* |
| Ga0126384_115372281 | 3300010046 | Tropical Forest Soil | HAAARNDGYWVRHFVPDNPSGADCIYCRLFPAHPHKH* |
| Ga0134082_100348123 | 3300010303 | Grasslands Soil | GHDLENQTFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPLQQHEH* |
| Ga0126372_128194952 | 3300010360 | Tropical Forest Soil | SFEYAAARNDGYWVRHFVPDNPSGADCIYCRLFPTHPHKH* |
| Ga0134125_109627601 | 3300010371 | Terrestrial Soil | NQSFEHAASRSEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH* |
| Ga0134128_108807231 | 3300010373 | Terrestrial Soil | NQSFEHAAARTDGYWVRHFMPENTSGADCIYCRLLPGGHKH* |
| Ga0126381_1002920841 | 3300010376 | Tropical Forest Soil | FERAASSGEGYWVRHFTLDNPTGADCIYCRLFPAHKHEH* |
| Ga0126381_1007235053 | 3300010376 | Tropical Forest Soil | EGEGAVEVVGHDLENQSFEHAASRRDGYWVRHFMLDNPTGADCIYCRLFPGHKH* |
| Ga0150983_150613582 | 3300011120 | Forest Soil | AVEVVGHDLENQTFEYAASPGDGYWVRHFMLDNPSGADCIYCRLFPNKHRH* |
| Ga0150983_166965182 | 3300011120 | Forest Soil | LEGEGAVEVVGHDLANQPFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPGHKH* |
| Ga0137399_107575521 | 3300012203 | Vadose Zone Soil | NQTFEYAASPGDGYWVRHFMLDNPTGADCIYCRLFPGHRH* |
| Ga0137361_105672692 | 3300012362 | Vadose Zone Soil | VGHDLENQTFEYAASRGDGYWVRHFMLDNPSGADCIYCRLFPAHRHH* |
| Ga0137416_103017263 | 3300012927 | Vadose Zone Soil | GHDLENQTFEYAASPGDGYWVRHFMLDNPSGADCIYCRLFPRRRYH* |
| Ga0126369_127410121 | 3300012971 | Tropical Forest Soil | SFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH* |
| Ga0134087_100962673 | 3300012977 | Grasslands Soil | LENQTFEHAASRGEGYWVRHFMLDNPTGADCIYCRLLPTQQHEH* |
| Ga0164305_116663172 | 3300012989 | Soil | EHAASRSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH* |
| Ga0134081_100396571 | 3300014150 | Grasslands Soil | HAASRGEGYWVRHFMLDNPTGADCIYCRLFPTQQHEH* |
| Ga0137411_12126252 | 3300015052 | Vadose Zone Soil | VEVVGHDLENQTFEYAASPGDGYWVRHFMLDNPTGADCIYCRLFPGHRH* |
| Ga0137420_10906894 | 3300015054 | Vadose Zone Soil | ETEGALELVGHDLENQTFEFAASRGDGYWVRHFMLDNPTGADCIYCRLFPAHRHH* |
| Ga0134073_100016435 | 3300015356 | Grasslands Soil | TFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPLQQHEH* |
| Ga0182034_104851532 | 3300016371 | Soil | VVGHDLGNQSFEHAASSSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0187825_100825431 | 3300017930 | Freshwater Sediment | LEKQSFEHAAASSDGYWVRHFMLGKPGGADCIYCRLFPAHRHEVRS |
| Ga0187779_101650201 | 3300017959 | Tropical Peatland | ERAAAPKDGPWVRHFILDNPTGADCIYCRLFPGHAHEH |
| Ga0187777_102827881 | 3300017974 | Tropical Peatland | EVVGHDLENQTLEHAASRAEGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0187784_103708401 | 3300018062 | Tropical Peatland | NQPFEHAASRGDGYWVRHFMLDNPTGADCIYCRLFPAHKHQH |
| Ga0187772_109087061 | 3300018085 | Tropical Peatland | SFEHAAARSDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0066669_104635541 | 3300018482 | Grasslands Soil | FEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPLQQHEH |
| Ga0182025_13542362 | 3300019786 | Permafrost | VIGHDLANQSAFEHAAASGEGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0179592_100254491 | 3300020199 | Vadose Zone Soil | LENQTFEFAASRADGYWVRHFMLDNPTGADCIYCRLFPAHRHH |
| Ga0210405_109958782 | 3300021171 | Soil | GAVEVVGHDLEKQSFEHAAARGEGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0210408_102531703 | 3300021178 | Soil | KQSFEHAAARGEGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0210396_114707142 | 3300021180 | Soil | NQSFEHAASRSDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0179585_10421841 | 3300021307 | Vadose Zone Soil | RNRRSVEVVGHDLENQTFEYAASRGDGYWVRHFMLDNPRRADCVYCRLFPSHRH |
| Ga0213874_100690172 | 3300021377 | Plant Roots | AEVVAHDLENQRFEQAAAPTEGYWVRHFMPDNPSGADCIYCRLFPGHRH |
| Ga0210397_114959262 | 3300021403 | Soil | GAAEVVGHDLESQSFEHAASSGDGYWVRHFMLDNPTGADCIYCRLFPGRHTH |
| Ga0210394_108852482 | 3300021420 | Soil | DLESQSFEHAASSGDGYWVRHFMLDNPTGADCIYCRLFPGRHTH |
| Ga0210391_115830511 | 3300021433 | Soil | QSAFERAAASGDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0210409_100735253 | 3300021559 | Soil | EGALEVVGHDLENQTFEHAASTGDGYWVRHFMLDNPTGADCFYCRLFPAHKHGH |
| Ga0242642_10330231 | 3300022504 | Soil | QTFEHAASTGDGYWVRHFMLDNPTGADCFYCRLFPAHKHGH |
| Ga0242642_10928732 | 3300022504 | Soil | EVVGHDLENQTFEYAASPGDGHWVRHFMLDNPTGADCIYCRLFPGHRHH |
| Ga0222729_10307071 | 3300022507 | Soil | EHAASRGDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0242662_102138931 | 3300022533 | Soil | LVGHDLENQTFEYAASTGDGYWVRHFMLDNPTGADCFYCRLFPAHKHGH |
| Ga0242675_10574622 | 3300022718 | Soil | ALEVVGHDIENQTFEYAASTGDGYWVRHFMLDNPTGADCFYCRLFPAHKHGH |
| Ga0242665_101253242 | 3300022724 | Soil | LEVVGHDLEKQSFEHAAARGEGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0137417_13133675 | 3300024330 | Vadose Zone Soil | DLENQTFEYAASREDGYWVRHFMLDNPSGADCIYCRLFPGHRHH |
| Ga0207699_100863294 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GAAEVVGHDLENQSFEHAASRGDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0207700_114431542 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | HAASRSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0209239_11071932 | 3300026310 | Grasslands Soil | EVVGHDLENQTFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPTQQHKH |
| Ga0209239_12311921 | 3300026310 | Grasslands Soil | YAASREDGYWVRHFMLDNPSGADCIYCRLFPRHRHH |
| Ga0209376_10455863 | 3300026540 | Soil | TFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPTQQHEH |
| Ga0209156_100803583 | 3300026547 | Soil | VGHDLENQTFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPTQQHKH |
| Ga0209474_101670193 | 3300026550 | Soil | TFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPLQQHEH |
| Ga0208068_1011612 | 3300026675 | Soil | GAVELVGHDLQNQSFEHAASRSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0209106_10955121 | 3300027616 | Forest Soil | LENQTFEYAASPDDGYWVRHFMLDNPTGADCIYCRLFPAHRH |
| Ga0209773_102472701 | 3300027829 | Bog Forest Soil | GHDLANQSAFEQAAASSDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0308309_115491292 | 3300028906 | Soil | EVVGHDLEKQSFEHAAARGEGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0210274_10764032 | 3300030531 | Soil | FSFFFLFGHDLGNQSAFERAAANGDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0210270_17126661 | 3300030581 | Soil | EVIGHDLGNQSAFERAAANGDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0073994_124209412 | 3300030991 | Soil | EGAVEVVGHDLENQTFEYAASTADGYWVRHFMLDNPTGADCVYCRLFPAHRHQ |
| Ga0170834_1001981003 | 3300031057 | Forest Soil | AFEHAAASGDGYWVRHFMLDNPSGADCIYCRLFPGHKH |
| Ga0170824_1027137301 | 3300031231 | Forest Soil | EVIGHDLGNQSAFERAAASGDGYWVRHFMLDNPSGADCIYCRLFPGHKH |
| Ga0318516_107079001 | 3300031543 | Soil | HDLQNQSFEHAASRRDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0318541_102693011 | 3300031545 | Soil | DLENQTFEHAASRGEGYWVRHFMLDNPSGADCIYCRLFPAHKHEH |
| Ga0318571_100475741 | 3300031549 | Soil | ASSGDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318571_102599501 | 3300031549 | Soil | LENQSFERAAARSEGYWVRHFMLDNPTGADCIYCRLFPAHRHTH |
| Ga0318573_100259501 | 3300031564 | Soil | SFERAASSGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318573_102083573 | 3300031564 | Soil | QTFEHAASRGEGYWVRHFMLDNPSGADCIYCRLFPAHKHEH |
| Ga0318515_100213921 | 3300031572 | Soil | DLANQTFERAASSGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318572_106807651 | 3300031681 | Soil | EHAASSSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318572_109203811 | 3300031681 | Soil | EVVGHDLENQTFERAASSGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0307476_112786152 | 3300031715 | Hardwood Forest Soil | EHAASRGEGYWVRHFMLDNPSGADCIYCRLFPTHKHEH |
| Ga0318493_104781141 | 3300031723 | Soil | AHDLESQTFERAASRGEGYWVRHFMLDNPTGADCIYCRLFPGHVHEH |
| Ga0318501_103333691 | 3300031736 | Soil | AVEVVAHDLENQTFERAASSGDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318501_106908241 | 3300031736 | Soil | NQTFEYAASRGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0307468_1010432082 | 3300031740 | Hardwood Forest Soil | AASSGEGYWVRHFMLDNPTGADCIYCRLFPGRHSH |
| Ga0318502_109642151 | 3300031747 | Soil | AASSGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318492_104378661 | 3300031748 | Soil | FERAASRGEGYWVRHFMLDNPTGADCIYCRLFPGHAHEH |
| Ga0318494_100764764 | 3300031751 | Soil | LENQTFEHAASRGEGYWVRHFMLDNPSGADCIYCRLFPAHKHEH |
| Ga0307477_103499742 | 3300031753 | Hardwood Forest Soil | VEVVGHDLEKQSFEHAAARGEGYWVRHFMLDNPTGADCIYCRLFPSHKHQH |
| Ga0318521_106036362 | 3300031770 | Soil | EHAASRADGYWVRHFMLDNPTGADCIYCRLFPGQHKH |
| Ga0318547_103506381 | 3300031781 | Soil | AFEHAASRGDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318497_100781063 | 3300031805 | Soil | AHDLESQTFERAASRGEGYWVRHFMLDNPTGADCIYCRLFPGHAHEH |
| Ga0307473_111945241 | 3300031820 | Hardwood Forest Soil | EFAASRSDGYWVRHFMLDNPTGADCIYCRLFPTHKHEH |
| Ga0310917_112041052 | 3300031833 | Soil | VVGHDLQNQSFEHAAARSEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318511_100681983 | 3300031845 | Soil | EVVAHDLESQTFERAASRGEGYWVRHFMLDNPTGADCIYCRLFPGHAHEH |
| Ga0318522_100556281 | 3300031894 | Soil | TFERAASSGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0306923_103798794 | 3300031910 | Soil | GHDLGNQSFEHAASSSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0306923_106285902 | 3300031910 | Soil | VGHDLENQTFEYAAARGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0310913_109032392 | 3300031945 | Soil | AHDLENQTFERAASSGDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0310909_109842072 | 3300031947 | Soil | DLENQSFERAASSSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318562_102753271 | 3300032008 | Soil | LGNQSFEHAASSSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318532_101464502 | 3300032051 | Soil | AASRGDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318570_102544861 | 3300032054 | Soil | AASSGDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318533_105848473 | 3300032059 | Soil | LESQTFERAASRGEGYWVRHFMLDNPTGADCIYCRLFPGHAHEH |
| Ga0318553_102562433 | 3300032068 | Soil | FEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318553_107012591 | 3300032068 | Soil | VAHDLENQAFEHAASRADGYWVRHFMLDNPTGADCIYCRLFPGQHKH |
| Ga0306924_117675321 | 3300032076 | Soil | GAVEVVGHDLENQTFERAASSGEGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0318525_102702683 | 3300032089 | Soil | AFEHAASRADGYWVRHFMLDNPTGADCIYCRLFPGQHKH |
| Ga0318525_102956762 | 3300032089 | Soil | FERAASSSDGYWVRHFMLDNPTGADCIYCRLFPAHKHEH |
| Ga0335078_119621592 | 3300032805 | Soil | VVGHDLAHQPFEHAASRGEGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| Ga0335076_112601861 | 3300032955 | Soil | KQSFEHAASRDDGYWVRHFMLGNAGGAHCIYCRLFPEHKHSHSP |
| Ga0335077_101771311 | 3300033158 | Soil | DLENQSFEHAASKSDGYWVRHFMLDNPTGADCIYCRLFPGHKH |
| ⦗Top⦘ |