


| Basic Information | |
|---|---|
| Family ID | F087675 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RLVFAPPLVIEAAEIEDISQRLERALDDVADDLKREGALG |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 97.27 % |
| % of genes from short scaffolds (< 2000 bps) | 87.27 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.909 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF03458 | Gly_transporter | 13.64 |
| PF02129 | Peptidase_S15 | 8.18 |
| PF03401 | TctC | 5.45 |
| PF13302 | Acetyltransf_3 | 3.64 |
| PF02798 | GST_N | 3.64 |
| PF00817 | IMS | 3.64 |
| PF00202 | Aminotran_3 | 2.73 |
| PF14520 | HHH_5 | 1.82 |
| PF13458 | Peripla_BP_6 | 1.82 |
| PF01048 | PNP_UDP_1 | 1.82 |
| PF11799 | IMS_C | 1.82 |
| PF00067 | p450 | 1.82 |
| PF13591 | MerR_2 | 1.82 |
| PF04909 | Amidohydro_2 | 1.82 |
| PF00557 | Peptidase_M24 | 0.91 |
| PF01435 | Peptidase_M48 | 0.91 |
| PF05199 | GMC_oxred_C | 0.91 |
| PF03640 | Lipoprotein_15 | 0.91 |
| PF02518 | HATPase_c | 0.91 |
| PF02738 | MoCoBD_1 | 0.91 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF11026 | DUF2721 | 0.91 |
| PF08240 | ADH_N | 0.91 |
| PF09250 | Prim-Pol | 0.91 |
| PF08530 | PepX_C | 0.91 |
| PF01370 | Epimerase | 0.91 |
| PF12973 | Cupin_7 | 0.91 |
| PF02653 | BPD_transp_2 | 0.91 |
| PF08032 | SpoU_sub_bind | 0.91 |
| PF00497 | SBP_bac_3 | 0.91 |
| PF01418 | HTH_6 | 0.91 |
| PF13410 | GST_C_2 | 0.91 |
| PF06736 | TMEM175 | 0.91 |
| PF02538 | Hydantoinase_B | 0.91 |
| PF00903 | Glyoxalase | 0.91 |
| PF13545 | HTH_Crp_2 | 0.91 |
| PF09084 | NMT1 | 0.91 |
| PF08837 | DUF1810 | 0.91 |
| PF09907 | HigB_toxin | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 13.64 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 5.45 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 3.64 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.82 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 1.82 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 1.82 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.82 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 1.82 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.91 |
| COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 0.91 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.91 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.91 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.91 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.91 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.91 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.91 % |
| Unclassified | root | N/A | 19.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_13858496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100574004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 582 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10011041 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300000956|JGI10216J12902_105723524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 510 | Open in IMG/M |
| 3300000956|JGI10216J12902_113632247 | Not Available | 707 | Open in IMG/M |
| 3300001431|F14TB_102310281 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300001661|JGI12053J15887_10181442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300004268|Ga0066398_10057554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300004633|Ga0066395_10858007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rubritepida → Rubritepida flocculans | 548 | Open in IMG/M |
| 3300005332|Ga0066388_107680679 | Not Available | 540 | Open in IMG/M |
| 3300005347|Ga0070668_101224768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300005364|Ga0070673_101501334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300005435|Ga0070714_100596828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300005436|Ga0070713_100301904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1474 | Open in IMG/M |
| 3300005467|Ga0070706_100179185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1978 | Open in IMG/M |
| 3300005518|Ga0070699_100098459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2562 | Open in IMG/M |
| 3300005559|Ga0066700_10017091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3959 | Open in IMG/M |
| 3300005586|Ga0066691_10241420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300005615|Ga0070702_101288143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300005713|Ga0066905_100821201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300005713|Ga0066905_100949477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300005842|Ga0068858_101305402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300006028|Ga0070717_10637744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
| 3300006059|Ga0075017_101685865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300006173|Ga0070716_100047039 | Not Available | 2431 | Open in IMG/M |
| 3300006175|Ga0070712_100929879 | Not Available | 750 | Open in IMG/M |
| 3300006176|Ga0070765_100263528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1584 | Open in IMG/M |
| 3300006847|Ga0075431_101412169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 655 | Open in IMG/M |
| 3300006903|Ga0075426_10525782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
| 3300006903|Ga0075426_11265954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300009553|Ga0105249_10890002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. EB88 | 957 | Open in IMG/M |
| 3300010047|Ga0126382_10003043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7199 | Open in IMG/M |
| 3300010047|Ga0126382_10140577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1636 | Open in IMG/M |
| 3300010048|Ga0126373_11195385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
| 3300010358|Ga0126370_11178454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300010359|Ga0126376_11463106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC277A00 | 710 | Open in IMG/M |
| 3300010361|Ga0126378_10244494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1886 | Open in IMG/M |
| 3300010361|Ga0126378_11888119 | Not Available | 680 | Open in IMG/M |
| 3300010362|Ga0126377_11288907 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300010398|Ga0126383_10319039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1561 | Open in IMG/M |
| 3300010398|Ga0126383_10344746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1507 | Open in IMG/M |
| 3300010398|Ga0126383_11492105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300012202|Ga0137363_10218497 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300012202|Ga0137363_11166703 | Not Available | 655 | Open in IMG/M |
| 3300012204|Ga0137374_10783389 | Not Available | 708 | Open in IMG/M |
| 3300012350|Ga0137372_10443678 | Not Available | 974 | Open in IMG/M |
| 3300012357|Ga0137384_10479443 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300012357|Ga0137384_11028106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 662 | Open in IMG/M |
| 3300012361|Ga0137360_11205892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300012948|Ga0126375_10812432 | Not Available | 742 | Open in IMG/M |
| 3300012957|Ga0164303_10942277 | Not Available | 609 | Open in IMG/M |
| 3300012961|Ga0164302_11082905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300012971|Ga0126369_10358945 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300013296|Ga0157374_11311064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. EB88 | 746 | Open in IMG/M |
| 3300014254|Ga0075312_1047487 | Not Available | 811 | Open in IMG/M |
| 3300015371|Ga0132258_11036332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2074 | Open in IMG/M |
| 3300015372|Ga0132256_100097848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2851 | Open in IMG/M |
| 3300015373|Ga0132257_102955982 | Not Available | 619 | Open in IMG/M |
| 3300015374|Ga0132255_100040904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5962 | Open in IMG/M |
| 3300015374|Ga0132255_100722350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1480 | Open in IMG/M |
| 3300016294|Ga0182041_10205999 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300016341|Ga0182035_10171971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1687 | Open in IMG/M |
| 3300016357|Ga0182032_10265086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC277A00 | 1342 | Open in IMG/M |
| 3300016371|Ga0182034_11366861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC277A00 | 619 | Open in IMG/M |
| 3300016387|Ga0182040_10997132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 698 | Open in IMG/M |
| 3300016404|Ga0182037_10489706 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300016422|Ga0182039_10904250 | Not Available | 788 | Open in IMG/M |
| 3300016445|Ga0182038_10207084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1548 | Open in IMG/M |
| 3300016445|Ga0182038_10225699 | Not Available | 1491 | Open in IMG/M |
| 3300017959|Ga0187779_10555750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Nisaea | 764 | Open in IMG/M |
| 3300018062|Ga0187784_11271208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300018422|Ga0190265_12859421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium NSP1-1 | 577 | Open in IMG/M |
| 3300020579|Ga0210407_11167388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC277A00 | 581 | Open in IMG/M |
| 3300021560|Ga0126371_10995282 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300025928|Ga0207700_11404530 | Not Available | 621 | Open in IMG/M |
| 3300025929|Ga0207664_10524301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300026852|Ga0207838_104317 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300027605|Ga0209329_1136402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis | 540 | Open in IMG/M |
| 3300031545|Ga0318541_10061098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1957 | Open in IMG/M |
| 3300031561|Ga0318528_10427356 | Not Available | 711 | Open in IMG/M |
| 3300031561|Ga0318528_10725704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300031573|Ga0310915_10634509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300031640|Ga0318555_10565029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300031679|Ga0318561_10046851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2150 | Open in IMG/M |
| 3300031719|Ga0306917_10846678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300031724|Ga0318500_10120263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1213 | Open in IMG/M |
| 3300031744|Ga0306918_10138110 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300031747|Ga0318502_10276829 | Not Available | 983 | Open in IMG/M |
| 3300031782|Ga0318552_10738052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300031795|Ga0318557_10290126 | Not Available | 751 | Open in IMG/M |
| 3300031835|Ga0318517_10086955 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300031860|Ga0318495_10143248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300031879|Ga0306919_10216773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1428 | Open in IMG/M |
| 3300031890|Ga0306925_10593186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis jejuensis | 1171 | Open in IMG/M |
| 3300031893|Ga0318536_10312472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300031897|Ga0318520_10903960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300031910|Ga0306923_10092385 | All Organisms → cellular organisms → Bacteria | 3407 | Open in IMG/M |
| 3300031910|Ga0306923_12511651 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031912|Ga0306921_10757599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1112 | Open in IMG/M |
| 3300031942|Ga0310916_11324071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC277A00 | 592 | Open in IMG/M |
| 3300031945|Ga0310913_11125073 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031954|Ga0306926_10091704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3713 | Open in IMG/M |
| 3300031954|Ga0306926_10264423 | Not Available | 2131 | Open in IMG/M |
| 3300032010|Ga0318569_10226574 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300032052|Ga0318506_10066231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1491 | Open in IMG/M |
| 3300032065|Ga0318513_10023417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2606 | Open in IMG/M |
| 3300032076|Ga0306924_11126792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 854 | Open in IMG/M |
| 3300032076|Ga0306924_12577850 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300032261|Ga0306920_100296096 | Not Available | 2410 | Open in IMG/M |
| 3300033289|Ga0310914_11055708 | Not Available | 713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026852 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 62 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_138584961 | 3300000363 | Soil | DRLVFAPPLVIETGEIEDVSARLERALDDVAADLGREGAVR* |
| INPhiseqgaiiFebDRAFT_1005740042 | 3300000364 | Soil | PPLVIEPPQIEQIGDRLEQALDDVAIELKNDGGLR* |
| AF_2010_repII_A1DRAFT_100110414 | 3300000597 | Forest Soil | LVFAPPLVIEASEIEDVSERLERALDDVADDLKREGALG* |
| JGI10216J12902_1057235241 | 3300000956 | Soil | PLVIEASEIEDISARLERALGDVGDDLKREGALG* |
| JGI10216J12902_1136322471 | 3300000956 | Soil | GLILRVVGDRLVFAPPLVIEPPQIEQIGERLEHALNDVAIELKNEGSLR* |
| F14TB_1023102812 | 3300001431 | Soil | APPLVIEPPQIEQIGERLEQALDDVSIELKNEGSLR* |
| JGI12053J15887_101814423 | 3300001661 | Forest Soil | APPLVIEPFDIEEIGIRLGRALDDVAKDLKCERKTH* |
| Ga0066398_100575541 | 3300004268 | Tropical Forest Soil | VVGDRLVFAPPLVIEAAEIEDVGERLKRALDDVAQDLGREGAMR* |
| Ga0066395_108580071 | 3300004633 | Tropical Forest Soil | NDRLVFAPPLVIESEDIEEIGQRLERALDAVAGDLEEHISR* |
| Ga0066388_1076806792 | 3300005332 | Tropical Forest Soil | LVRVIGDRLVFAPPLVIEAADIEDIAARLHRALNDVADDLAREGALG* |
| Ga0070668_1012247682 | 3300005347 | Switchgrass Rhizosphere | LVFAPPLIIEEAEIEEIARRLKLGLDDVAKELKSEGALN* |
| Ga0070673_1015013342 | 3300005364 | Switchgrass Rhizosphere | LRVVGDRLVFAPPLVVEPLQIELIGERLEQALDDVAIELKNESS* |
| Ga0070714_1005968283 | 3300005435 | Agricultural Soil | RLVFAPPLVIEPSDIEEIGSRLERALYDVAKDLKHERKIH* |
| Ga0070713_1003019043 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVFAPPLVIETGEIEDVSARLERALDDVAADLGREGAVR* |
| Ga0070706_1001791852 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VGDRLVFAPPLVIETAEIEDVSERLERALDDVADDLGREGASR* |
| Ga0070699_1000984594 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVFAPPLVIETAEIEDVSERLERALDDVADDLGREGASR* |
| Ga0066700_100170911 | 3300005559 | Soil | VFAPPLVIETTEIEDVSERLERALDDVADDLGREGALR* |
| Ga0066691_102414203 | 3300005586 | Soil | PLVIETGEIEDVSARLERALDDVAADLGREGAVR* |
| Ga0070702_1012881431 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VGDRLVFAPPLIIEEAEIEEIARRLKLGLDDVAKELKSEGALN* |
| Ga0066905_1008212012 | 3300005713 | Tropical Forest Soil | LILRVVGDRLVFAPPLVIEPPQIELISERLEQALDDVAIELKNDGSL* |
| Ga0066905_1009494772 | 3300005713 | Tropical Forest Soil | RVVGDRLVFAPPLVIEAAEIEDVSARLERALDDVAEDLRRERALP* |
| Ga0068858_1013054021 | 3300005842 | Switchgrass Rhizosphere | RVVGDRLVFAPPLVVEPLQIELIGERLEQALDDVAIELKNESS* |
| Ga0070717_106377442 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAFAPPLVIEAHEIEDIGERLRRALDDVLTELKGEGALQ* |
| Ga0075017_1016858651 | 3300006059 | Watersheds | IGDRLVFAPPLVIESHDIDEISKRLERALDDVARDLKEDMLS* |
| Ga0070716_1000470394 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAPPLVIEAAEIEDIAARLHRALNEVADDLTREGALR* |
| Ga0070712_1009298792 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAPPLVIEAAEIEDIAARLHRALNEVADDLTREGALG* |
| Ga0070765_1002635283 | 3300006176 | Soil | DRLVFAPPLIIEATEIEEIGARLERALDDVSDELTREGAWR* |
| Ga0075431_1014121692 | 3300006847 | Populus Rhizosphere | FAPPLVIEASEIEDISARLERALDDVADDLKREGALG* |
| Ga0075426_105257821 | 3300006903 | Populus Rhizosphere | VIGDRLVFAPPLVIEAADIEDIAARLEHALNDVADDLAREGALG* |
| Ga0075426_112659542 | 3300006903 | Populus Rhizosphere | VFAPPLVIEPPQIEQIGERLEQALDDVSIELKNEGSLR* |
| Ga0105249_108900022 | 3300009553 | Switchgrass Rhizosphere | VFAPPLVIEPPQIELIGERLEQALDDVAIELKNESS* |
| Ga0126382_100030431 | 3300010047 | Tropical Forest Soil | DRLVFAPPLVIEPPQVELIGERLERALDDVAIELKNEGSL* |
| Ga0126382_101405774 | 3300010047 | Tropical Forest Soil | LVFAPPLVIEAAEIEDVGERLERALDDVAQDLGREGAMR* |
| Ga0126373_111953851 | 3300010048 | Tropical Forest Soil | VFAPPLVIEAAEIEDVSERLERALDDVAADLAREGALR* |
| Ga0126370_111784541 | 3300010358 | Tropical Forest Soil | RVVGDRLVFAPPLVIEAAEIEDVGERLERALDDVAQDLGREGVVR* |
| Ga0126376_114631061 | 3300010359 | Tropical Forest Soil | APPLIIEAHEIEDIGARLRRALDDVFTELKSEGALD* |
| Ga0126378_102444943 | 3300010361 | Tropical Forest Soil | LVFAPPLVIEAAEIEDVSERLERALDDVAADLAREGALR* |
| Ga0126378_118881191 | 3300010361 | Tropical Forest Soil | PPLVIEPPQIEQIGERLELALDDVAIELKNEGSLR* |
| Ga0126377_112889071 | 3300010362 | Tropical Forest Soil | RLVFAPPLVIETGEIEDVSARLERALNDVAADLGREGAVR* |
| Ga0126383_103190391 | 3300010398 | Tropical Forest Soil | PLVIEAADIEDIAARLERALNDVADDLAREGALG* |
| Ga0126383_103447463 | 3300010398 | Tropical Forest Soil | LRVVGDRLVFAPPLVIEAAEIEDVSARLERALDDVAEDLRHERALP* |
| Ga0126383_114921052 | 3300010398 | Tropical Forest Soil | LIRVVGDRLVFAPPLVIEAAEIEDVSARLERALDDVAQDLGREGVVR* |
| Ga0137363_102184973 | 3300012202 | Vadose Zone Soil | PLVIEAAEIEDVSERLKRALDDVAQDLGREGAVR* |
| Ga0137363_111667033 | 3300012202 | Vadose Zone Soil | RLVFAPPLVIEAEDIEAIGERLERALDDVADELTREGALG* |
| Ga0137374_107833893 | 3300012204 | Vadose Zone Soil | LRVVGDRLVFAPPLVIEASEIEDISARLERALDDVADDLKREGALE* |
| Ga0137372_104436783 | 3300012350 | Vadose Zone Soil | GDRLVFAPPLVIEASEIEDISARLERALDDVADDLKREGALE* |
| Ga0137384_104794431 | 3300012357 | Vadose Zone Soil | APPLVIEAAEIEDVSARLERALDDVAADLGREGALR* |
| Ga0137384_110281061 | 3300012357 | Vadose Zone Soil | LVFAPPLVIEASEIEDISTRLERALDDVADDLKREGALG* |
| Ga0137360_112058922 | 3300012361 | Vadose Zone Soil | RVVGDRLVFAPPLVIEAAEIEEIGERLERGLDDVADELSREGVSG* |
| Ga0126375_108124321 | 3300012948 | Tropical Forest Soil | LVFAPPLIIEAYEIEQLGERLERALDDVATELKREGALA* |
| Ga0164303_109422771 | 3300012957 | Soil | PPLVIEAAEIEDIAARLHRALNEVADDLTREGALR* |
| Ga0164302_110829052 | 3300012961 | Soil | LFLRTVGDRLVFAPPLIIEASDIEEIAKRLKLGLDDVAKELKSEGVLV* |
| Ga0126369_103589453 | 3300012971 | Tropical Forest Soil | PPLVIEAADIEDIAARLERALNDVADDLAREGALG* |
| Ga0157374_113110642 | 3300013296 | Miscanthus Rhizosphere | VFAPPLVVEPLQIELIGERLEQALDDVAIELKNESS* |
| Ga0075312_10474873 | 3300014254 | Natural And Restored Wetlands | DRLVLAPPLVIEEDDIAEIGTRLARALDDVADDLRSDGAFA* |
| Ga0132258_110363324 | 3300015371 | Arabidopsis Rhizosphere | RLVFAPPLIIEPAEIEEIGERLERALDDVAGDLAREGIFK* |
| Ga0132256_1000978484 | 3300015372 | Arabidopsis Rhizosphere | VVGDRLVFAPPLVIEAHEIEEIGQRLQRALDDVAGDLKSEGRLA* |
| Ga0132257_1029559822 | 3300015373 | Arabidopsis Rhizosphere | LVFAPPLVIEAHEIEEIGQRLQRALDDVARDLKSEGRLA* |
| Ga0132255_1000409041 | 3300015374 | Arabidopsis Rhizosphere | PPLVIEAADIEDIAARLHRALNDVADDLAREGALG* |
| Ga0132255_1007223504 | 3300015374 | Arabidopsis Rhizosphere | PLVIETHEIEEIGKRLQRALDDVAGELKGEGCFA* |
| Ga0182041_102059992 | 3300016294 | Soil | LVFAPPLVIESQDIDEIRQRLEQALDDVASDLTENDLM |
| Ga0182035_101719711 | 3300016341 | Soil | RVVGDRLVFAPPLVIEAPEVEEIGERLECALDDVAGELTQEGALA |
| Ga0182032_102650861 | 3300016357 | Soil | RVIGDRLVFAPPLVIEAHEIEDIGERLRRALDDVLTELNGEGALQ |
| Ga0182034_113668612 | 3300016371 | Soil | FAPPLVIEAHEIEDIGERLRRALDDVLTELNGEGALQ |
| Ga0182040_109971321 | 3300016387 | Soil | GDRLVFAPPLVIEAEEIEEISERLERALDDVAQDLKREGALN |
| Ga0182037_104897063 | 3300016404 | Soil | DRLVFAPPLVIEAAEIEDISQRLERALDDVADDLKREGALG |
| Ga0182039_109042502 | 3300016422 | Soil | VFAPPLIIEAQEIDEIGRRLQWALDDVASDLQSERHTQPI |
| Ga0182038_102070841 | 3300016445 | Soil | IRVVCDRLVFAPPVVIEAAEIEGVGERLERALDDVAQDLGREGAVR |
| Ga0182038_102256992 | 3300016445 | Soil | FAPPLIIEASEIEEIAARLERALDDVADELTREGAWR |
| Ga0187779_105557503 | 3300017959 | Tropical Peatland | VGDRLVFAPPLVIEAQEIEEIGRRLHRALDDVAMDLKNERALQ |
| Ga0187784_112712081 | 3300018062 | Tropical Peatland | LRVVGDRLVFAPPLVIEAEDIAEIGRRLERALDDVAADLRREGAS |
| Ga0190265_128594211 | 3300018422 | Soil | LHRRVEVVAPPLVIEADEIEEIGVRLERALDDVAEDLEREGVFA |
| Ga0210407_111673882 | 3300020579 | Soil | DRLVFAPPLVIEAHEIEDIGERLRRALDDVLTELKREGALQ |
| Ga0126371_109952821 | 3300021560 | Tropical Forest Soil | VIGDRLVFAPPLVIEAEEITEIGRRLGRALNDVAKDLKSEGVL |
| Ga0207700_114045303 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FAPPLVIEAAEIEDIAARLHRALNEVADDLTREGALR |
| Ga0207664_105243011 | 3300025929 | Agricultural Soil | RLVFAPPLVIEPSDIEEIGSRLERALYDVAKDLKHERKIH |
| Ga0207838_1043171 | 3300026852 | Tropical Forest Soil | PPLVIEASEIEEIGERLERALDDVARDLGREAALR |
| Ga0209329_11364022 | 3300027605 | Forest Soil | LVFAPPLVIETTEIEAVGERLEHALDDVAADLGREGALR |
| Ga0318541_100610981 | 3300031545 | Soil | IGDRLVFAPPLVIEAHEIEDIGERLRRALDDVLTELNGEGALQ |
| Ga0318528_104273562 | 3300031561 | Soil | GDRLVFAPPLIIESEDIEEISQRLERALDDVARDLERLSI |
| Ga0318528_107257042 | 3300031561 | Soil | LLRVVGDRLVFAPSLVIETGEIEDVSARLERALDDVAADLKREGALR |
| Ga0310915_106345091 | 3300031573 | Soil | GDRLVFAPPLVIEAAEIEAVSERLERAFDDVADDLGREGALR |
| Ga0318555_105650292 | 3300031640 | Soil | LVFAPPLVIETAEIEDVSERLERALDDVAADLAREGALR |
| Ga0318561_100468513 | 3300031679 | Soil | IRVVGDRLVFAPPVVIEAAEIEGVGERLERALDDVAQDLEREGAVR |
| Ga0306917_108466781 | 3300031719 | Soil | GDCLVFAPPLVIESHDIDEIGQRLERALDDVARDLKEDDIR |
| Ga0318500_101202631 | 3300031724 | Soil | APPLIIEAHEIEEIGQRLERALDDVAIDLKREGALSQELAQYRS |
| Ga0306918_101381102 | 3300031744 | Soil | IGDRLVFAPPLVIEAEEITEISRRLGRALDDVAKDLKSEGVL |
| Ga0318502_102768291 | 3300031747 | Soil | APPLVIEAAEIEDISQRLERALDDVADDLKREGALG |
| Ga0318552_107380522 | 3300031782 | Soil | LRVVGDRLVFAPPLVIETGEIEDVSARLERALDDVAADLKREGALR |
| Ga0318557_102901261 | 3300031795 | Soil | VGDRLVFAPPLIIEAHEIEEIGQRLERALDDVAIDLKREGALSQELAQYRS |
| Ga0318517_100869552 | 3300031835 | Soil | LRVVGDRLVFAPPLVIESQDIDEIRQRLEQALDDVASDLTENDLM |
| Ga0318495_101432481 | 3300031860 | Soil | LIRVVGDRLVFAPPVVIEAAEIEGVGERLERALDDVAQDLEREGAVR |
| Ga0306919_102167731 | 3300031879 | Soil | FAPPLVIEAAEIEDISQRLERALDDVADDLKREGALG |
| Ga0306925_105931861 | 3300031890 | Soil | VVGDGWVIEAHEIEGIGERLRRALDDVLTELKGEGALQ |
| Ga0318536_103124722 | 3300031893 | Soil | LILRVVGDRLVFAPPLVIEPDDIEQIGSRLDRALGDVTQDLRGEGVLN |
| Ga0318520_109039601 | 3300031897 | Soil | RLVFAPPLVIESHEIDEIGQRLERALDDVARDLKEDDIR |
| Ga0306923_100923854 | 3300031910 | Soil | VFAPPLVIEAAEIEDVGERLERALDDVAQDLGREGVVR |
| Ga0306923_125116512 | 3300031910 | Soil | PPLVIEAEEIEEISERLERALDDVAQDLKREGALN |
| Ga0306921_107575991 | 3300031912 | Soil | MFALPLIIEAFEIEEIAARLERALDDVANELMREGALGCAFSSYH |
| Ga0310916_113240712 | 3300031942 | Soil | LVFAPPLVIEAHEIEGIGERLRRALDDVLTELKGEGALQ |
| Ga0310913_111250733 | 3300031945 | Soil | IIRVIGDRLVFAPPLIIESEDIEEISQRLERALDDVARDLERLSI |
| Ga0306926_100917041 | 3300031954 | Soil | DRLVFAPPLVIESQDIDEIRQRLEQALDDVASDLTENDLM |
| Ga0306926_102644231 | 3300031954 | Soil | RVIGDRLVFAPPLIIESEDIEEISQRPERALDDVARDLE |
| Ga0318569_102265741 | 3300032010 | Soil | VGDRLVFAPPLVIEAGEIEDVSARLERALDDVAADLGREGVLR |
| Ga0318506_100662312 | 3300032052 | Soil | RLVFAPPLVIEAAEIEGVGERLERALDDVAQDLGREGAVR |
| Ga0318513_100234171 | 3300032065 | Soil | DRLVFAPPLVIESHDIDEIGQRLERALDDVARDLKEDDLR |
| Ga0306924_111267921 | 3300032076 | Soil | DRLVFAPPLIIESEDIEEISQRLERALDDVARDLERLSI |
| Ga0306924_125778501 | 3300032076 | Soil | DRLVFAPPLVIETGEIEDVSARLERALDDVAADLGREGVVR |
| Ga0306920_1002960961 | 3300032261 | Soil | IGDRLVFAPPLIIESEDIEEISQRPERALDDVARDLE |
| Ga0310914_110557083 | 3300033289 | Soil | RLVFAPPLVIEAAEIEDISQRLERALDDVADDLKREGALG |
| ⦗Top⦘ |