


| Basic Information | |
|---|---|
| Family ID | F087669 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LAAPLERKLKSSVRFRRGQRVASGLGMIGLGAYVALADTK |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.82 % |
| % of genes near scaffold ends (potentially truncated) | 96.36 % |
| % of genes from short scaffolds (< 2000 bps) | 87.27 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.455 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF05167 | DUF711 | 7.27 |
| PF01408 | GFO_IDH_MocA | 7.27 |
| PF00072 | Response_reg | 4.55 |
| PF13302 | Acetyltransf_3 | 4.55 |
| PF13456 | RVT_3 | 2.73 |
| PF02738 | MoCoBD_1 | 2.73 |
| PF00440 | TetR_N | 1.82 |
| PF11848 | DUF3368 | 1.82 |
| PF10518 | TAT_signal | 1.82 |
| PF01676 | Metalloenzyme | 1.82 |
| PF08861 | DUF1828 | 0.91 |
| PF01979 | Amidohydro_1 | 0.91 |
| PF05016 | ParE_toxin | 0.91 |
| PF01113 | DapB_N | 0.91 |
| PF01402 | RHH_1 | 0.91 |
| PF04773 | FecR | 0.91 |
| PF01694 | Rhomboid | 0.91 |
| PF00356 | LacI | 0.91 |
| PF00144 | Beta-lactamase | 0.91 |
| PF03741 | TerC | 0.91 |
| PF02517 | Rce1-like | 0.91 |
| PF09286 | Pro-kuma_activ | 0.91 |
| PF13508 | Acetyltransf_7 | 0.91 |
| PF12704 | MacB_PCD | 0.91 |
| PF13231 | PMT_2 | 0.91 |
| PF03683 | UPF0175 | 0.91 |
| PF13193 | AMP-binding_C | 0.91 |
| PF01425 | Amidase | 0.91 |
| PF02774 | Semialdhyde_dhC | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 7.27 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.91 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.91 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.91 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.91 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.91 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.91 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.91 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.45 % |
| Unclassified | root | N/A | 24.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c1136585 | Not Available | 519 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100351165 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300005332|Ga0066388_102694301 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005406|Ga0070703_10233183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| 3300005553|Ga0066695_10762460 | Not Available | 561 | Open in IMG/M |
| 3300005602|Ga0070762_11084800 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005610|Ga0070763_10312955 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005842|Ga0068858_102282573 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005983|Ga0081540_1208931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300006173|Ga0070716_100119641 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300006173|Ga0070716_101846121 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006176|Ga0070765_100831307 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006176|Ga0070765_100856620 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300006176|Ga0070765_100926067 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300006358|Ga0068871_101521552 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006796|Ga0066665_10144968 | Not Available | 1796 | Open in IMG/M |
| 3300006796|Ga0066665_11106728 | Not Available | 604 | Open in IMG/M |
| 3300006797|Ga0066659_10759512 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006904|Ga0075424_101018089 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300007258|Ga0099793_10596306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300009038|Ga0099829_10072794 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2610 | Open in IMG/M |
| 3300009038|Ga0099829_11312423 | Not Available | 598 | Open in IMG/M |
| 3300009038|Ga0099829_11754881 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009089|Ga0099828_10216878 | Not Available | 1710 | Open in IMG/M |
| 3300009098|Ga0105245_12816445 | Not Available | 539 | Open in IMG/M |
| 3300010358|Ga0126370_11576395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300010359|Ga0126376_12553337 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010360|Ga0126372_10356625 | Not Available | 1314 | Open in IMG/M |
| 3300010360|Ga0126372_10673628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300010379|Ga0136449_100818299 | Not Available | 1535 | Open in IMG/M |
| 3300011270|Ga0137391_10617159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300011271|Ga0137393_10378308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300012096|Ga0137389_10251946 | Not Available | 1484 | Open in IMG/M |
| 3300012189|Ga0137388_10820720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300012189|Ga0137388_11883206 | Not Available | 528 | Open in IMG/M |
| 3300012202|Ga0137363_10272576 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300012205|Ga0137362_10138033 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300012205|Ga0137362_10622267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300012361|Ga0137360_10739907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300012361|Ga0137360_11091394 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012362|Ga0137361_10986814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300012362|Ga0137361_11307369 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012363|Ga0137390_10137503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2424 | Open in IMG/M |
| 3300012363|Ga0137390_10933588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300012582|Ga0137358_11027731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300012683|Ga0137398_10610627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012683|Ga0137398_11259691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300012923|Ga0137359_11650090 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012924|Ga0137413_11536308 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012929|Ga0137404_10847044 | Not Available | 832 | Open in IMG/M |
| 3300012971|Ga0126369_10881179 | Not Available | 980 | Open in IMG/M |
| 3300012971|Ga0126369_13298949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300014157|Ga0134078_10632040 | Not Available | 517 | Open in IMG/M |
| 3300014166|Ga0134079_10012591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2601 | Open in IMG/M |
| 3300016357|Ga0182032_10628539 | Not Available | 896 | Open in IMG/M |
| 3300017933|Ga0187801_10180557 | Not Available | 831 | Open in IMG/M |
| 3300017942|Ga0187808_10612365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis | 505 | Open in IMG/M |
| 3300018006|Ga0187804_10013811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2827 | Open in IMG/M |
| 3300020199|Ga0179592_10412592 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300020199|Ga0179592_10424280 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300020579|Ga0210407_10055568 | Not Available | 2959 | Open in IMG/M |
| 3300020579|Ga0210407_10174586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1664 | Open in IMG/M |
| 3300020579|Ga0210407_11056807 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300020579|Ga0210407_11139496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300020579|Ga0210407_11378274 | Not Available | 524 | Open in IMG/M |
| 3300020580|Ga0210403_11174752 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300020581|Ga0210399_10005542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9808 | Open in IMG/M |
| 3300020582|Ga0210395_11309885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300020583|Ga0210401_10164164 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300021088|Ga0210404_10043149 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300021168|Ga0210406_10805157 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300021178|Ga0210408_10087301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2449 | Open in IMG/M |
| 3300021401|Ga0210393_10830969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300021432|Ga0210384_10916131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300021475|Ga0210392_10566872 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300025885|Ga0207653_10208757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 738 | Open in IMG/M |
| 3300025906|Ga0207699_10261379 | Not Available | 1196 | Open in IMG/M |
| 3300026089|Ga0207648_11316237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300026332|Ga0209803_1054697 | Not Available | 1750 | Open in IMG/M |
| 3300026557|Ga0179587_11182081 | Not Available | 503 | Open in IMG/M |
| 3300027562|Ga0209735_1053882 | Not Available | 863 | Open in IMG/M |
| 3300027610|Ga0209528_1100997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300027671|Ga0209588_1052442 | Not Available | 1319 | Open in IMG/M |
| 3300027846|Ga0209180_10422088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300027855|Ga0209693_10251423 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300027857|Ga0209166_10239544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300027879|Ga0209169_10161475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300027882|Ga0209590_10013778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3893 | Open in IMG/M |
| 3300027903|Ga0209488_11104971 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300028047|Ga0209526_10032573 | All Organisms → cellular organisms → Bacteria | 3666 | Open in IMG/M |
| 3300028536|Ga0137415_10038978 | All Organisms → cellular organisms → Bacteria | 4652 | Open in IMG/M |
| 3300028536|Ga0137415_10286466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1452 | Open in IMG/M |
| 3300028906|Ga0308309_10988991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300028906|Ga0308309_11074457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300029636|Ga0222749_10673746 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031231|Ga0170824_113753456 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 527 | Open in IMG/M |
| 3300031231|Ga0170824_123924105 | Not Available | 517 | Open in IMG/M |
| 3300031573|Ga0310915_10481720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300031719|Ga0306917_11221218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300031753|Ga0307477_10885402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300031754|Ga0307475_10962979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300031779|Ga0318566_10534540 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031792|Ga0318529_10340015 | Not Available | 699 | Open in IMG/M |
| 3300031820|Ga0307473_10658766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300031962|Ga0307479_10325136 | Not Available | 1520 | Open in IMG/M |
| 3300032174|Ga0307470_10107242 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300032174|Ga0307470_10200264 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300032205|Ga0307472_100828526 | Not Available | 848 | Open in IMG/M |
| 3300032261|Ga0306920_100002471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 23379 | Open in IMG/M |
| 3300032954|Ga0335083_10409051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.18% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_11365852 | 2228664022 | Soil | ERKLKSSTGFRRRQRTASGLGMIGLGAYLALSDSK |
| JGIcombinedJ26739_1003511651 | 3300002245 | Forest Soil | VVLLAAPLERKLKSSPRFRSRQRVASGLGMIGLGAYVGLKPS* |
| Ga0066388_1026943012 | 3300005332 | Tropical Forest Soil | DLVVVYLAAPLEKKLKSSAKFRSRQRVASGIGMIGLGAYVAFADNK* |
| Ga0070703_102331831 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | ALSAPLERKLKSSARFRRGQRTAAGFGMISLGAYLAFSDSK* |
| Ga0066695_107624601 | 3300005553 | Soil | VVGMASPLERKLKNSVRFRRRQRTASGLGMIGLGAYLALADSK* |
| Ga0070762_110848002 | 3300005602 | Soil | VVMLAAPLEQKLKHNARFRSRQRVASGLGMIGLGAYVALADTR* |
| Ga0070763_103129552 | 3300005610 | Soil | IERKLKNSATFRRRQRVASGLGMIGLGAYVALADSR* |
| Ga0068858_1022825731 | 3300005842 | Switchgrass Rhizosphere | ADLLVVALSAPLERKLKSSVRFRRAQRTASGLGMISLGAYLAFSDVK* |
| Ga0081540_12089311 | 3300005983 | Tabebuia Heterophylla Rhizosphere | APLERKLKSSARFRRGQRTASGIGMISLGAYLALSDAK* |
| Ga0070716_1001196413 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LLVVSLATPFERKLKSSGTFRRRQRTASGLAMIGLGAYVALSDAK* |
| Ga0070716_1018461211 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ERKLKHSAKFRRRQRLASGLGMIGLGAYVAFADTK* |
| Ga0070765_1008313071 | 3300006176 | Soil | PLEQKLKHNPRFRSRQRMASGVGMVGLGAYVALADAR* |
| Ga0070765_1008566202 | 3300006176 | Soil | VVLLAIPIERKLKNSATFRHRQRVASGLGMIGLGAYLALADAK* |
| Ga0070765_1009260672 | 3300006176 | Soil | LAIPIERKLKSSATFRRRQRVASGLGMIGLGAYVALADTK* |
| Ga0068871_1015215521 | 3300006358 | Miscanthus Rhizosphere | ERKLKSSPTFRSRQRTASGLGMIGLGAYLALSDAK* |
| Ga0066665_101449681 | 3300006796 | Soil | ERKLNPSTTFRRRQRTAFGLGMISLGAYVALSDAK* |
| Ga0066665_111067282 | 3300006796 | Soil | RKLKSSATFRRGQRVASGVGMIGLGAYVAFADTK* |
| Ga0066659_107595122 | 3300006797 | Soil | LAAPLERKLKSSVRFRRGQRVASGLGMITLGTYVAIADTR* |
| Ga0075424_1010180893 | 3300006904 | Populus Rhizosphere | RKLKSSVRFRRAQRTASGLGMISLGAYLAFSDVK* |
| Ga0099793_105963063 | 3300007258 | Vadose Zone Soil | AAPLGRKLKASATFRRRQRVASGFGMIGLGAYVALTDSR* |
| Ga0099829_100727943 | 3300009038 | Vadose Zone Soil | RKLKNSVRFRRRQRVASGLGMIGLGAYVALADSK* |
| Ga0099829_113124232 | 3300009038 | Vadose Zone Soil | ARLERQLKNSVRFRRRQRAASGLGMIGLGAYVALVDSK* |
| Ga0099829_117548812 | 3300009038 | Vadose Zone Soil | VSLAAPLGRKLKASATFRRRQRVASGFGMIGLGAYVALTDNK* |
| Ga0099828_102168783 | 3300009089 | Vadose Zone Soil | LVVVFMAAPLERKLRNSAPFRRRQRVASGVGMIGLGAYVAFGDSK* |
| Ga0105245_128164451 | 3300009098 | Miscanthus Rhizosphere | ADLAVVSLAAPLERKLKSSARFRRGQRTASGLGMIGLGAYLAFSESK* |
| Ga0126370_115763952 | 3300010358 | Tropical Forest Soil | LAVVSLAAPLERKLKSSVAFRRGQRTASGLGMIGLGAYLAFSESK* |
| Ga0126376_125533372 | 3300010359 | Tropical Forest Soil | AADLAVVSLAAPLERKLKSSAGFRRGQRTASGLGMIGLGAYLAFSESK* |
| Ga0126372_103566251 | 3300010360 | Tropical Forest Soil | VVSLAAPLERKLKSSARFRRTQRTTSGLGMIGLGAYLAFSDSK* |
| Ga0126372_106736281 | 3300010360 | Tropical Forest Soil | DLVVVYSAAPLERKLKSSEKFRNRQRVASGVGMIGLGAYVAFADSK* |
| Ga0136449_1008182991 | 3300010379 | Peatlands Soil | LAAPLERKLKNSARFRRGQRVASGVGMITLGAYVAFADSR* |
| Ga0137391_106171591 | 3300011270 | Vadose Zone Soil | LERKLKHSTKFRRRQRVASGLGMIGLGAYVAFADTK* |
| Ga0137393_103783081 | 3300011271 | Vadose Zone Soil | APLERKLKSSVRFRRGQRVASGLGMITLGAYVALADSQ* |
| Ga0137389_102519461 | 3300012096 | Vadose Zone Soil | PLERKLKSSPTFRARQRTASGLGMIGLGAYVALSDAK* |
| Ga0137388_108207202 | 3300012189 | Vadose Zone Soil | LAAPLERKLKSSVRFRRGQRVASGLGMIGLGAYVALADTK* |
| Ga0137388_118832061 | 3300012189 | Vadose Zone Soil | PLERKLKTNVRFRRRQRTASGLGMIGLGAYLALDDSK* |
| Ga0137363_102725761 | 3300012202 | Vadose Zone Soil | APLERKLKSSVHFRRRQRVASGLGMIGLGAYVALAERN* |
| Ga0137362_101380333 | 3300012205 | Vadose Zone Soil | DLLVVSLAAPLERKLKESARFRRGQRVASGVGMIGLGAYVAFADTK* |
| Ga0137362_106222672 | 3300012205 | Vadose Zone Soil | DLVVVFMAAPLQRKLKNSAKFRRRQRLASGLGMIGLGAYVAFADTK* |
| Ga0137360_107399073 | 3300012361 | Vadose Zone Soil | FMAAPLERKLKNSVRFRRRQRVASGVGMIGLGAYVAFADSK* |
| Ga0137360_110913941 | 3300012361 | Vadose Zone Soil | LATPLERKLKSSPTFRARQRTASGLGMIGLGAYVALSDAK* |
| Ga0137361_109868141 | 3300012362 | Vadose Zone Soil | GRKLKASATFRRRQRVASGFGMIGLGAYVALTDSK* |
| Ga0137361_113073693 | 3300012362 | Vadose Zone Soil | LGRKLKASATFRRRQRVASGFGMIGLGAYVALTDSR* |
| Ga0137390_101375033 | 3300012363 | Vadose Zone Soil | VSLAAPLGRKLKASATFRRRQRVASGFGMIGLGAYVALTDTR* |
| Ga0137390_109335883 | 3300012363 | Vadose Zone Soil | DLVVVFMAAPLERKLKNSVRFRRRQRVASGVGMIGLGAYAAFADSK* |
| Ga0137358_110277311 | 3300012582 | Vadose Zone Soil | ADLVVVYLAAPLERKLKSSATFRRGQRVASGLGMIGLGVYVAFADTK* |
| Ga0137398_106106271 | 3300012683 | Vadose Zone Soil | LVVSLATPLERKLKSSPTFRARQRTASGLGMIGLGAYVALSDAK* |
| Ga0137398_112596912 | 3300012683 | Vadose Zone Soil | SLAAPLGRKLKASATFRRRQRVASGFGMIGLGAYVALTDSK* |
| Ga0137359_116500902 | 3300012923 | Vadose Zone Soil | LGRKLKASATFRRRQRVASGFGMIGLGAYVALTDSK* |
| Ga0137413_115363082 | 3300012924 | Vadose Zone Soil | MAAPLERKLKTSVKFRRRQRLASGLGMIGLGAYVASADTK* |
| Ga0137404_108470441 | 3300012929 | Vadose Zone Soil | LERKLKKSVKFRRRQRLASGLGMIGLGAYVAFADTK* |
| Ga0126369_108811792 | 3300012971 | Tropical Forest Soil | RKLKSSAKFRSRQRVASGVGMIGLGAYVVFADSK* |
| Ga0126369_132989491 | 3300012971 | Tropical Forest Soil | AAPLERKLKHSTTFRRRQRVASGLGMIGLGAYVAFADSK* |
| Ga0134078_106320401 | 3300014157 | Grasslands Soil | ERKLKNSIRFRRRQRTACGLGMIGLGAYLALADSK* |
| Ga0134079_100125911 | 3300014166 | Grasslands Soil | PLERKLKNSVRFRRRQRTASGLGMIGLGAYLALADSK* |
| Ga0182032_106285392 | 3300016357 | Soil | ADLAVVSLAAPLERKLKSSARFRRGQRTASGLGMIGLGAYLAFSESK |
| Ga0187801_101805571 | 3300017933 | Freshwater Sediment | MAAPLERKLKNSIRFRRHQRVASGVGMIGLGAYLAFSDAK |
| Ga0187808_106123652 | 3300017942 | Freshwater Sediment | CMAAPLEHKLKNSIRFRRRQRVVSGLGMIGLGAYLAFADTK |
| Ga0187804_100138111 | 3300018006 | Freshwater Sediment | LERKLKNSIRFRRRQRVASGVGMIGLGAYLAFADTK |
| Ga0179592_104125921 | 3300020199 | Vadose Zone Soil | AADLLVVSLATPLERKLKSSPTFRASQRTASGLGMIGLGAYVALSDAK |
| Ga0179592_104242801 | 3300020199 | Vadose Zone Soil | AVSLAAPLERKLKSSPTFRRRQRTASGVGMIGLGVYVALSDAK |
| Ga0210407_100555687 | 3300020579 | Soil | AAPLERKLKNSVRFRRRQRVVSGLGMIGLGAYVALPDSK |
| Ga0210407_101745863 | 3300020579 | Soil | LLAIPIERKLKNSVTFRRRQRVASGLGMIGLGAYVALADNR |
| Ga0210407_110568071 | 3300020579 | Soil | LVVVFLAGPLERKLKGSERFRRRQRVASGVGMIALGAYVALADSK |
| Ga0210407_111394962 | 3300020579 | Soil | VFLAAPLERKLKNSARFRRRQRVASGVGMIGLGAYVALADSK |
| Ga0210407_113782741 | 3300020579 | Soil | AIPIERKLKNSATFRRRQRVASGLGMIGLGAYVALADSR |
| Ga0210403_111747521 | 3300020580 | Soil | PLERKLKGSERCRRRQRVASGVGMIALGAYVALADSK |
| Ga0210399_100055428 | 3300020581 | Soil | VLAAPLERKLKSSARFRRGQRTASGLGMITLGAYVALADTQ |
| Ga0210395_113098851 | 3300020582 | Soil | AAPLERKLKHSAKFRRRQRVASGLGMIGLGAYVAFADTK |
| Ga0210401_101641643 | 3300020583 | Soil | AIPIERKLKNSATFRRRQRVASGLGMIGLGAYVALADTK |
| Ga0210404_100431493 | 3300021088 | Soil | APLERKLKSSARFRRGQRTASGLGMITLGAYVALADTQ |
| Ga0210406_108051573 | 3300021168 | Soil | DLAVVFLAAPLERKLRNSVRFRRRQRVASGLGMIGLGAYVALAERN |
| Ga0210408_100873012 | 3300021178 | Soil | ADLVVVLLAIPIERKLKNSATFRRRQRVASGLGMIGLGAYVALADSR |
| Ga0210393_108309691 | 3300021401 | Soil | VVVLLAIPIERKLKNSATFRRRQRVASGLGMIGLGAYVALADSR |
| Ga0210384_109161311 | 3300021432 | Soil | LLAAPLEQKLKHNARFRSRQRVASGLGMIGLGAYVALADTK |
| Ga0210392_105668721 | 3300021475 | Soil | ERKLKSSVRFRRGQRVASGSAMIALGVYVAAADGS |
| Ga0207653_102087571 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | ALSAPLERKLKSSARFRRGQRTAAGFGMISLGAYLAFSDSK |
| Ga0207699_102613791 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ERKLKTSAKFRSRQRIASGAGMIGLGAYVAFADSK |
| Ga0207648_113162371 | 3300026089 | Miscanthus Rhizosphere | TAADLAVVRLAAPLERKLKSSARFRRGQRTASGLGMIGLGAYLAFSESK |
| Ga0209803_10546971 | 3300026332 | Soil | VVALAAPLERKLKSSVRFHRGQRVASGLGMITLGTYVALADTR |
| Ga0179587_111820812 | 3300026557 | Vadose Zone Soil | APLERKLKSSPSFRARQRTASGLGMIGLGAYVALSDAK |
| Ga0209735_10538821 | 3300027562 | Forest Soil | PIERKLKSSATFRSRQRVASGLGMIGLGAYVALADTK |
| Ga0209528_11009971 | 3300027610 | Forest Soil | EQKLKHSARFRSRQRVASGLGMIGLGAYVALADAK |
| Ga0209588_10524423 | 3300027671 | Vadose Zone Soil | VFMAAPLERKLKNSAKFRRRQRLASGLGMIGLGAYVAFADSK |
| Ga0209180_104220882 | 3300027846 | Vadose Zone Soil | LGRKLKASATFRRRQRVASGFGMIGLGAYVALTDNK |
| Ga0209693_102514231 | 3300027855 | Soil | PIERKLKNSATFRRRQRVASGLGMIGLGAYVALADSR |
| Ga0209166_102395442 | 3300027857 | Surface Soil | LVVSLAAPLERKLKSSARFRRAQRIASGLGMIGLGAYLAFSDSK |
| Ga0209169_101614752 | 3300027879 | Soil | MKRAGPVVVLLAAPLEQKLQHNARFRSRQRVASGLGMIGLGAYVALADTK |
| Ga0209590_100137783 | 3300027882 | Vadose Zone Soil | VLAAPLERKLKSSARFRRGQRVASGLGMISLGAYVALGDTQ |
| Ga0209488_111049712 | 3300027903 | Vadose Zone Soil | LLVVSLATPLERQLKSSPTFRARQRIASGLGMIGLGAYVALCDAK |
| Ga0209526_100325734 | 3300028047 | Forest Soil | LVVVLAAPLERKLKSSARFRRGQRTASGLGMITLGAYVALADTQ |
| Ga0137415_100389785 | 3300028536 | Vadose Zone Soil | FMAAPLERKLKNSVRFRRRQRVASGVGMIGLGAYVAFADSK |
| Ga0137415_102864661 | 3300028536 | Vadose Zone Soil | VVVFMAAPLERKLKNSVKFRRRQRLASGLGMIGLGAYVAFADTK |
| Ga0308309_109889912 | 3300028906 | Soil | TLNTAADLVVVLLAIPIERKLKNSATFRHRQRVASGLGMIGLGAYLALADAK |
| Ga0308309_110744571 | 3300028906 | Soil | IPIERKLKNSATFRRRQRVASGLGMIGLGAYVALADSR |
| Ga0222749_106737461 | 3300029636 | Soil | ADLLVVLAGAPLEQKLKHNPRFRSRQRIASGVGMIGLGAYVALADAR |
| Ga0170824_1137534562 | 3300031231 | Forest Soil | CAAPLERKLKSSAKFRSRQRTASGLGMIGLGAYLAVSESK |
| Ga0170824_1239241051 | 3300031231 | Forest Soil | LVVSCAAPLERKLKSSPTFRRRQRTASGLGMISLGAYLALSDSK |
| Ga0310915_104817202 | 3300031573 | Soil | MSSSCCSPPLERKLKNTAPFRRRQHVVSGLGVIGLGAYVAFADTK |
| Ga0306917_112212182 | 3300031719 | Soil | LERKLKSSLRFRARQRTASGAGMIGLGAYLAFSDIHR |
| Ga0307477_108854021 | 3300031753 | Hardwood Forest Soil | ALAVPLERKLKSSVRFRRGQRVASGVGMITLGSYVALADTR |
| Ga0307475_109629791 | 3300031754 | Hardwood Forest Soil | LLVVLAAAPLEQKLKHSARFRSRQRVASGVGMIGLGAYVALADAK |
| Ga0318566_105345402 | 3300031779 | Soil | PLERKLKNSVRFRRRQRTASGLGMIGLGAYLALAEPK |
| Ga0318529_103400152 | 3300031792 | Soil | SVSLNTAADLAVVSLSARIERKIKTSARFRRNQRCASGLGMIGLGAYLALAEPK |
| Ga0307473_106587662 | 3300031820 | Hardwood Forest Soil | PLERKLKTSVRFRRGQRVASGLGMITLGAYVALADTQ |
| Ga0307479_103251362 | 3300031962 | Hardwood Forest Soil | LLVVILAIPFERKLKSSVRFRRGQRVASGLGMITLGTYVAIADTR |
| Ga0307470_101072421 | 3300032174 | Hardwood Forest Soil | ADLLVVSLATPLERKLKSSATFRRRQRTASGFGMIGLGAYLALSDAK |
| Ga0307470_102002641 | 3300032174 | Hardwood Forest Soil | LVVALSAPLERKLKSSVRFHRAQCTASGLGMIGLGAYLAFSDSK |
| Ga0307472_1008285261 | 3300032205 | Hardwood Forest Soil | VSLATPFERKLRSSGSFRRRQRTASGLAMIGMGAYVGLSDAK |
| Ga0306920_1000024711 | 3300032261 | Soil | MASPLERKLKDSMRFRRRQRTVSGIGMIGLGAYLALADSK |
| Ga0335083_104090511 | 3300032954 | Soil | DLVVVLAAAPLERKLKNSPTFRSRQRVASGVGMIGLGAYVAFADSK |
| ⦗Top⦘ |