


| Basic Information | |
|---|---|
| Family ID | F087646 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 46 residues |
| Representative Sequence | PTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 94.55 % |
| % of genes from short scaffolds (< 2000 bps) | 92.73 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 0.00% Coil/Unstructured: 75.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01557 | FAA_hydrolase | 44.55 |
| PF00903 | Glyoxalase | 11.82 |
| PF13343 | SBP_bac_6 | 1.82 |
| PF00355 | Rieske | 1.82 |
| PF00596 | Aldolase_II | 0.91 |
| PF01370 | Epimerase | 0.91 |
| PF13449 | Phytase-like | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.18 % |
| Unclassified | root | N/A | 11.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig515474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 2170459021|G14TP7Y02JZFY2 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300000443|F12B_10214213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1043014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1011941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1224 | Open in IMG/M |
| 3300001991|JGI24743J22301_10119860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300002155|JGI24033J26618_1059707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300002459|JGI24751J29686_10025328 | Not Available | 1231 | Open in IMG/M |
| 3300002914|JGI25617J43924_10002748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4938 | Open in IMG/M |
| 3300004114|Ga0062593_102891841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300004463|Ga0063356_100084829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3366 | Open in IMG/M |
| 3300004463|Ga0063356_104906152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300004633|Ga0066395_10302095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 875 | Open in IMG/M |
| 3300005332|Ga0066388_100494769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1859 | Open in IMG/M |
| 3300005338|Ga0068868_101328627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300005365|Ga0070688_100396411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1021 | Open in IMG/M |
| 3300005439|Ga0070711_101427700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300005540|Ga0066697_10475914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300005548|Ga0070665_101367044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300005560|Ga0066670_10787064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300005564|Ga0070664_100836685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 861 | Open in IMG/M |
| 3300005764|Ga0066903_102427005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin1 | 1014 | Open in IMG/M |
| 3300005764|Ga0066903_102786533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin1 | 948 | Open in IMG/M |
| 3300005764|Ga0066903_105706048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300005764|Ga0066903_105737764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300006173|Ga0070716_100668706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300006186|Ga0075369_10545443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300006195|Ga0075366_10529637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300006755|Ga0079222_12273006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300006796|Ga0066665_10128206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1900 | Open in IMG/M |
| 3300007255|Ga0099791_10660804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300009089|Ga0099828_10383718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
| 3300009792|Ga0126374_10243685 | Not Available | 1169 | Open in IMG/M |
| 3300010046|Ga0126384_10324293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1275 | Open in IMG/M |
| 3300010046|Ga0126384_10544337 | Not Available | 1008 | Open in IMG/M |
| 3300010047|Ga0126382_10450918 | Not Available | 1020 | Open in IMG/M |
| 3300010159|Ga0099796_10121254 | Not Available | 1005 | Open in IMG/M |
| 3300010336|Ga0134071_10526542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300010359|Ga0126376_10993011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300010359|Ga0126376_12735384 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010360|Ga0126372_12890740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300010361|Ga0126378_11952582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300010398|Ga0126383_11275831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300012207|Ga0137381_10986368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300012208|Ga0137376_10077244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2784 | Open in IMG/M |
| 3300012469|Ga0150984_108162257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300012908|Ga0157286_10126139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300012917|Ga0137395_10516900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin1 | 860 | Open in IMG/M |
| 3300012924|Ga0137413_10107183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1755 | Open in IMG/M |
| 3300012948|Ga0126375_10239776 | Not Available | 1220 | Open in IMG/M |
| 3300012960|Ga0164301_10067064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1927 | Open in IMG/M |
| 3300012971|Ga0126369_10355673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1488 | Open in IMG/M |
| 3300012971|Ga0126369_12007756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300012971|Ga0126369_13346857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300014150|Ga0134081_10302663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300016294|Ga0182041_11263197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300016341|Ga0182035_11065704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300016357|Ga0182032_12047599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300018028|Ga0184608_10060385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1516 | Open in IMG/M |
| 3300018433|Ga0066667_10980951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300018433|Ga0066667_11637161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300018468|Ga0066662_10217679 | Not Available | 1528 | Open in IMG/M |
| 3300018476|Ga0190274_10829045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 985 | Open in IMG/M |
| 3300018482|Ga0066669_11275859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300019873|Ga0193700_1058496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300022756|Ga0222622_10289864 | Not Available | 1123 | Open in IMG/M |
| 3300025321|Ga0207656_10080142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1466 | Open in IMG/M |
| 3300025903|Ga0207680_10803424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300025930|Ga0207701_10215287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1684 | Open in IMG/M |
| 3300025960|Ga0207651_10037060 | All Organisms → cellular organisms → Bacteria | 3191 | Open in IMG/M |
| 3300026088|Ga0207641_11897124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300026320|Ga0209131_1086565 | Not Available | 1679 | Open in IMG/M |
| 3300026499|Ga0257181_1077907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300026552|Ga0209577_10413348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
| 3300026552|Ga0209577_10592081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300027383|Ga0209213_1011971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1582 | Open in IMG/M |
| 3300027616|Ga0209106_1148310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300027663|Ga0208990_1042699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1389 | Open in IMG/M |
| 3300027671|Ga0209588_1021430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2030 | Open in IMG/M |
| 3300027738|Ga0208989_10061711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1291 | Open in IMG/M |
| 3300027846|Ga0209180_10144089 | Not Available | 1371 | Open in IMG/M |
| 3300027882|Ga0209590_10294618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin1 | 1041 | Open in IMG/M |
| 3300027909|Ga0209382_10200909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2285 | Open in IMG/M |
| 3300028047|Ga0209526_10586592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300028380|Ga0268265_12449021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300028790|Ga0307283_10130445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
| 3300028793|Ga0307299_10386892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300031446|Ga0170820_14834510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300031469|Ga0170819_13312132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300031549|Ga0318571_10100926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin1 | 944 | Open in IMG/M |
| 3300031564|Ga0318573_10170058 | Not Available | 1148 | Open in IMG/M |
| 3300031564|Ga0318573_10417266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
| 3300031736|Ga0318501_10050272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1945 | Open in IMG/M |
| 3300031736|Ga0318501_10517702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300031748|Ga0318492_10392050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300031769|Ga0318526_10272406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300031819|Ga0318568_10857371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300031879|Ga0306919_10093842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2096 | Open in IMG/M |
| 3300031880|Ga0318544_10039309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1676 | Open in IMG/M |
| 3300031890|Ga0306925_11417832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. KK5 | 684 | Open in IMG/M |
| 3300031892|Ga0310893_10546727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300031893|Ga0318536_10006888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 4661 | Open in IMG/M |
| 3300031897|Ga0318520_10594711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300031946|Ga0310910_10167461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1690 | Open in IMG/M |
| 3300031946|Ga0310910_10591962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300032051|Ga0318532_10069424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1225 | Open in IMG/M |
| 3300032094|Ga0318540_10134472 | Not Available | 1179 | Open in IMG/M |
| 3300032261|Ga0306920_101071258 | Not Available | 1170 | Open in IMG/M |
| 3300033290|Ga0318519_10348810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 874 | Open in IMG/M |
| 3300033550|Ga0247829_10298591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1307 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.82% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_06843190 | 2124908045 | Soil | GRIPTRHDVPVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK |
| 4NP_02508320 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | ADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR |
| F12B_102142132 | 3300000443 | Soil | KRGRMPARSDVPINPAHVSDRLKDRKIIATIFGGDEQRKWQGLFKEIFTPK* |
| AF_2010_repII_A01DRAFT_10430141 | 3300000580 | Forest Soil | PAYVSDRLKDRKIIATIFGGQEQKKWQGLFKDIFRXR* |
| AP72_2010_repI_A100DRAFT_10119411 | 3300000837 | Forest Soil | DVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK* |
| JGI24743J22301_101198602 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | LSRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| JGI24033J26618_10597071 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| JGI24751J29686_100253282 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| JGI25617J43924_100027481 | 3300002914 | Grasslands Soil | VNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKVIFKPR* |
| Ga0062593_1028918412 | 3300004114 | Soil | LTKRGRMPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR* |
| Ga0063356_1000848293 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VPVNPPHVTDVLKDRKIIATIFAGDEQKKWQGLFKEIFRAR* |
| Ga0063356_1049061521 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPR* |
| Ga0066395_103020952 | 3300004633 | Tropical Forest Soil | HDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK* |
| Ga0066388_1004947693 | 3300005332 | Tropical Forest Soil | DVPVNPADITDRLKDRKIIATIFSGEDQKKWQGLFKNIFKPK* |
| Ga0068868_1013286272 | 3300005338 | Miscanthus Rhizosphere | FLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0070688_1003964112 | 3300005365 | Switchgrass Rhizosphere | MPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR* |
| Ga0070711_1014277002 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK* |
| Ga0066697_104759141 | 3300005540 | Soil | KRGRMPTRADVPVNPADVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK* |
| Ga0070665_1013670441 | 3300005548 | Switchgrass Rhizosphere | AEQFLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0066670_107870642 | 3300005560 | Soil | PHVQDLLQGKKIVATIFAGEEQKKWQGLFREIFKPR* |
| Ga0070664_1008366851 | 3300005564 | Corn Rhizosphere | PAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0066903_1024270051 | 3300005764 | Tropical Forest Soil | LTTRGRIPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK* |
| Ga0066903_1027865331 | 3300005764 | Tropical Forest Soil | VAEMLKERKIIATIFAGEEQKKWQGLFKDIFKQR* |
| Ga0066903_1057060482 | 3300005764 | Tropical Forest Soil | TRQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKEIFKPK* |
| Ga0066903_1057377642 | 3300005764 | Tropical Forest Soil | PTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKEIFKPK* |
| Ga0070716_1006687062 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QFLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0075369_105454431 | 3300006186 | Populus Endosphere | VNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0075366_105296372 | 3300006195 | Populus Endosphere | FLTRRGRMPTRTDVPVNPAHMSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0079222_122730061 | 3300006755 | Agricultural Soil | KRGRMPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR* |
| Ga0066665_101282063 | 3300006796 | Soil | PTRADVPVNPADVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK* |
| Ga0099791_106608042 | 3300007255 | Vadose Zone Soil | KRGRMPTRTDVPVNPAEVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK* |
| Ga0099828_103837183 | 3300009089 | Vadose Zone Soil | VTDVLKDRKIIATIFAGEEQKKWQGLFKEIFRSR* |
| Ga0126374_102436852 | 3300009792 | Tropical Forest Soil | PTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK* |
| Ga0126384_103242933 | 3300010046 | Tropical Forest Soil | DVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKEIFKPK* |
| Ga0126384_105443371 | 3300010046 | Tropical Forest Soil | MPTRTDVPVNPPAVAEMLKERKIIATIFAGEEQKKWQGLFKDIFKAR* |
| Ga0126382_104509182 | 3300010047 | Tropical Forest Soil | VNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK* |
| Ga0099796_101212542 | 3300010159 | Vadose Zone Soil | PTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPR* |
| Ga0134071_105265421 | 3300010336 | Grasslands Soil | MPTRHDVTVNPPSVSEALKGKEIIATIFAGEEQKKWQGLFKEIFRPR* |
| Ga0126376_109930111 | 3300010359 | Tropical Forest Soil | RQDVPVNPAYVSERLKDRKIIATIFAGDGQKKWQGLFKDIFKPK* |
| Ga0126376_127353843 | 3300010359 | Tropical Forest Soil | PHVSEMLKGRKIIATIFAGEEQKKWQGLFKDIFKPR* |
| Ga0126372_128907402 | 3300010360 | Tropical Forest Soil | AYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK* |
| Ga0126378_119525821 | 3300010361 | Tropical Forest Soil | HDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK* |
| Ga0126383_112758312 | 3300010398 | Tropical Forest Soil | MTTRGRMPTRHDVRVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFRPK* |
| Ga0137381_109863681 | 3300012207 | Vadose Zone Soil | RGRMPTRADVPVNPADITDRLKERTIIATIFSGEEQKKWQGLFKDIFKPK* |
| Ga0137376_100772441 | 3300012208 | Vadose Zone Soil | DVPVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPR* |
| Ga0150984_1081622571 | 3300012469 | Avena Fatua Rhizosphere | PVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0157286_101261391 | 3300012908 | Soil | RADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR* |
| Ga0137395_105169001 | 3300012917 | Vadose Zone Soil | PGVTEILMERKIIATIFAGEEQKKWQGLFKQIFKSR* |
| Ga0137413_101071832 | 3300012924 | Vadose Zone Soil | VSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0126375_102397762 | 3300012948 | Tropical Forest Soil | LTKRGRMPTRQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK* |
| Ga0164301_100670641 | 3300012960 | Soil | TRTDVPVNPAHVSERLKERKIVATIFAGEEQKKWQGLFKEIFKPR* |
| Ga0126369_103556733 | 3300012971 | Tropical Forest Soil | QLLTRRGRMPTRLDVPVNPAHVGDMLKERKIIATIFAGDEQKKWQGLFKDIFKPR* |
| Ga0126369_120077562 | 3300012971 | Tropical Forest Soil | PVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK* |
| Ga0126369_133468572 | 3300012971 | Tropical Forest Soil | EQFLTTRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK* |
| Ga0134081_103026631 | 3300014150 | Grasslands Soil | VTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK* |
| Ga0182041_112631971 | 3300016294 | Soil | NPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFRPK |
| Ga0182035_110657041 | 3300016341 | Soil | TMRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFRPK |
| Ga0182032_120475992 | 3300016357 | Soil | RGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK |
| Ga0184608_100603851 | 3300018028 | Groundwater Sediment | RMPTRADVQVNPAGVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0066667_109809511 | 3300018433 | Grasslands Soil | PVNPADVTDRLKDRTIIATIFSGQEQKKWQGLFKDVFKPN |
| Ga0066667_116371612 | 3300018433 | Grasslands Soil | VPINPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK |
| Ga0066662_102176791 | 3300018468 | Grasslands Soil | NPPHVSDVLKGRQIIATIFAGEEQKKWQGLFREIFKPR |
| Ga0190274_108290452 | 3300018476 | Soil | PVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0066669_112758593 | 3300018482 | Grasslands Soil | MPTRADVPVNPADITDRLKERTIIATIFSGEEQKKWQGLFKDVFKPK |
| Ga0193700_10584962 | 3300019873 | Soil | GVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0222622_102898642 | 3300022756 | Groundwater Sediment | ELFLTKRGRMPTREDVPINPPQVGDMLKERKIVATIFAGEEQKKWQGLFKDIFRPR |
| Ga0207656_100801421 | 3300025321 | Corn Rhizosphere | TRTDEPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0207680_108034242 | 3300025903 | Switchgrass Rhizosphere | TRADVPVNPSDVSERLNDRKIIATIFAGDAQKKWQGLFKEIFRPR |
| Ga0207701_102152871 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0207651_100370601 | 3300025960 | Switchgrass Rhizosphere | EQFLTGRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0207641_118971242 | 3300026088 | Switchgrass Rhizosphere | MPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR |
| Ga0209131_10865652 | 3300026320 | Grasslands Soil | TDVPVNPAEVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFRPK |
| Ga0257181_10779072 | 3300026499 | Soil | YVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK |
| Ga0209577_104133481 | 3300026552 | Soil | QFLTKSGRMPTRRDVAINPPHVQDLLQGKKIVATIFAGEEQKKWQGLFREIFKPR |
| Ga0209577_105920812 | 3300026552 | Soil | DVPVNPADVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK |
| Ga0209213_10119713 | 3300027383 | Forest Soil | FLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFRPR |
| Ga0209106_11483102 | 3300027616 | Forest Soil | RMPTREDVPVNPPQVGDMLKERKIVATIFAGEEQKRWQGLFKDIFRPR |
| Ga0208990_10426993 | 3300027663 | Forest Soil | TKRGRMPTRTDVPINPPHVSERLKERKIIATIFAGEEQKKWQGLFKEIFRPR |
| Ga0209588_10214301 | 3300027671 | Vadose Zone Soil | FREFLTTRGRMPTRHDVPVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK |
| Ga0208989_100617111 | 3300027738 | Forest Soil | TREDVPVNPPQVGDMLKERKIVATIFAGEEQKRWQGLFKDIFRPR |
| Ga0209180_101440891 | 3300027846 | Vadose Zone Soil | QFLTQRGRMPTRPDVPVNPPAAAERLKGKKIIATIFAGEEQKRWQGLFKEIFKQR |
| Ga0209590_102946182 | 3300027882 | Vadose Zone Soil | FLTRRGRMPTRPDVPVNPPHVTDVLKDRKIIATIFAGEEQKKWQGLFKEIFRSR |
| Ga0209382_102009091 | 3300027909 | Populus Rhizosphere | VNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR |
| Ga0209526_105865922 | 3300028047 | Forest Soil | MPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK |
| Ga0268265_124490212 | 3300028380 | Switchgrass Rhizosphere | PVNPSDVGERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR |
| Ga0307283_101304452 | 3300028790 | Soil | ADVQVNPAGVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0307299_103868921 | 3300028793 | Soil | GRMPTREDVPVNPPQVGDMLKERKIVATIFAGEEQKKWQGLFKDIFRPR |
| Ga0170820_148345101 | 3300031446 | Forest Soil | RGRMPTRADVQVNPADVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0170819_133121322 | 3300031469 | Forest Soil | EAEQFLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0318571_101009261 | 3300031549 | Soil | VPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0318573_101700581 | 3300031564 | Soil | NPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0318573_104172661 | 3300031564 | Soil | VLVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0318501_100502721 | 3300031736 | Soil | QFLTKRGRMPTRQNVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0318501_105177021 | 3300031736 | Soil | LLTKRGRMPTRPDVPINPAYVSDRLKDRKIIATIFGGQEQKKWQGLFKDIFRPR |
| Ga0318492_103920501 | 3300031748 | Soil | MPTRQDVPVNPPYVQEVLKGREIIATIFAGEEQKKWQGLFKEIFKPR |
| Ga0318526_102724062 | 3300031769 | Soil | EQFLTKRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0318568_108573711 | 3300031819 | Soil | QFLTTRGRMPTRHDVRVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFRPK |
| Ga0306919_100938421 | 3300031879 | Soil | TRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK |
| Ga0318544_100393091 | 3300031880 | Soil | KRGRMPTRQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0306925_114178323 | 3300031890 | Soil | PDVPVNPPSVTEALLERKVIATIFTGEEQKKWQGLFKQIFKPR |
| Ga0310893_105467271 | 3300031892 | Soil | GRMPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR |
| Ga0318536_100068887 | 3300031893 | Soil | YVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0318520_105947112 | 3300031897 | Soil | GNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFRPK |
| Ga0310910_101674613 | 3300031946 | Soil | DVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0310910_105919622 | 3300031946 | Soil | MPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIF |
| Ga0318532_100694243 | 3300032051 | Soil | QDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0318540_101344721 | 3300032094 | Soil | FLTTRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQKKWQGLFKDIFKSK |
| Ga0306920_1010712582 | 3300032261 | Soil | RIPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK |
| Ga0318519_103488102 | 3300033290 | Soil | QFLTKRGRMPTRQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK |
| Ga0247829_102985911 | 3300033550 | Soil | DVPVNPAHVSERLKERKIVATIFAGEEQKKWQGLFKEIFKPR |
| ⦗Top⦘ |