


| Basic Information | |
|---|---|
| Family ID | F087567 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.82 % |
| % of genes near scaffold ends (potentially truncated) | 48.18 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF10503 | Esterase_PHB | 4.55 |
| PF00884 | Sulfatase | 2.73 |
| PF12244 | DUF3606 | 2.73 |
| PF13545 | HTH_Crp_2 | 1.82 |
| PF00011 | HSP20 | 1.82 |
| PF00239 | Resolvase | 1.82 |
| PF00872 | Transposase_mut | 1.82 |
| PF01548 | DEDD_Tnp_IS110 | 0.91 |
| PF00912 | Transgly | 0.91 |
| PF13546 | DDE_5 | 0.91 |
| PF04392 | ABC_sub_bind | 0.91 |
| PF01346 | FKBP_N | 0.91 |
| PF06078 | DUF937 | 0.91 |
| PF00916 | Sulfate_transp | 0.91 |
| PF00166 | Cpn10 | 0.91 |
| PF07536 | HWE_HK | 0.91 |
| PF11306 | DUF3108 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.82 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.82 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.82 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.91 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.91 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.91 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.91 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.91 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.27 % |
| Unclassified | root | N/A | 42.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig567402 | Not Available | 558 | Open in IMG/M |
| 2166559005|cont_contig101682 | Not Available | 567 | Open in IMG/M |
| 2170459002|F0B48LX02GJN3Z | Not Available | 540 | Open in IMG/M |
| 2170459003|FZ032L002HBB3Y | Not Available | 514 | Open in IMG/M |
| 3300000156|NODE_c0732167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8401 | Open in IMG/M |
| 3300001545|JGI12630J15595_10086625 | Not Available | 615 | Open in IMG/M |
| 3300001867|JGI12627J18819_10085944 | Not Available | 1304 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100229107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1749 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100339146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1385 | Open in IMG/M |
| 3300002906|JGI25614J43888_10004851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4294 | Open in IMG/M |
| 3300004114|Ga0062593_100830484 | Not Available | 924 | Open in IMG/M |
| 3300004463|Ga0063356_106066107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 518 | Open in IMG/M |
| 3300004480|Ga0062592_101036732 | Not Available | 753 | Open in IMG/M |
| 3300005146|Ga0066817_1003864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300005147|Ga0066821_1003157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300005180|Ga0066685_10968893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300005356|Ga0070674_100088630 | Not Available | 2227 | Open in IMG/M |
| 3300005434|Ga0070709_10260114 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300005436|Ga0070713_100928591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 838 | Open in IMG/M |
| 3300005440|Ga0070705_101083441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300005445|Ga0070708_100113134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2496 | Open in IMG/M |
| 3300005467|Ga0070706_100771541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300005545|Ga0070695_101767892 | Not Available | 518 | Open in IMG/M |
| 3300005564|Ga0070664_101785355 | Not Available | 583 | Open in IMG/M |
| 3300005615|Ga0070702_101184978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300005718|Ga0068866_10627890 | Not Available | 729 | Open in IMG/M |
| 3300005841|Ga0068863_100620198 | Not Available | 1071 | Open in IMG/M |
| 3300006028|Ga0070717_10677596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300006028|Ga0070717_12160557 | Not Available | 500 | Open in IMG/M |
| 3300006038|Ga0075365_10201736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1393 | Open in IMG/M |
| 3300006038|Ga0075365_10731839 | Not Available | 699 | Open in IMG/M |
| 3300006049|Ga0075417_10447508 | Not Available | 644 | Open in IMG/M |
| 3300006175|Ga0070712_100393933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300006576|Ga0074047_11902926 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006794|Ga0066658_10798972 | Not Available | 532 | Open in IMG/M |
| 3300006844|Ga0075428_100389211 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300006904|Ga0075424_100755815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300009100|Ga0075418_10533645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1261 | Open in IMG/M |
| 3300009100|Ga0075418_11036488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 888 | Open in IMG/M |
| 3300009100|Ga0075418_12207912 | Not Available | 600 | Open in IMG/M |
| 3300009143|Ga0099792_10914415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300009147|Ga0114129_12764594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300009176|Ga0105242_12786341 | Not Available | 539 | Open in IMG/M |
| 3300009551|Ga0105238_11763819 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009840|Ga0126313_10604627 | Not Available | 884 | Open in IMG/M |
| 3300010373|Ga0134128_11053751 | Not Available | 898 | Open in IMG/M |
| 3300010399|Ga0134127_10356322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1431 | Open in IMG/M |
| 3300010403|Ga0134123_13649143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 500 | Open in IMG/M |
| 3300011120|Ga0150983_12539512 | Not Available | 538 | Open in IMG/M |
| 3300012022|Ga0120191_10160235 | Not Available | 521 | Open in IMG/M |
| 3300012189|Ga0137388_10015339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5591 | Open in IMG/M |
| 3300012205|Ga0137362_11184881 | Not Available | 648 | Open in IMG/M |
| 3300012285|Ga0137370_10967536 | Not Available | 525 | Open in IMG/M |
| 3300012906|Ga0157295_10039860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1067 | Open in IMG/M |
| 3300012923|Ga0137359_10101206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2545 | Open in IMG/M |
| 3300012941|Ga0162652_100068481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300012951|Ga0164300_10028851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2015 | Open in IMG/M |
| 3300012955|Ga0164298_10356152 | Not Available | 929 | Open in IMG/M |
| 3300012955|Ga0164298_10640611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300012955|Ga0164298_10973391 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012984|Ga0164309_10096580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1854 | Open in IMG/M |
| 3300012985|Ga0164308_10761505 | Not Available | 841 | Open in IMG/M |
| 3300012985|Ga0164308_12181685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → Dongia mobilis | 516 | Open in IMG/M |
| 3300012988|Ga0164306_12023950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300013297|Ga0157378_10530740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1180 | Open in IMG/M |
| 3300013306|Ga0163162_10953858 | Not Available | 969 | Open in IMG/M |
| 3300015077|Ga0173483_10755985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300015371|Ga0132258_10051700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9405 | Open in IMG/M |
| 3300015374|Ga0132255_100730129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1473 | Open in IMG/M |
| 3300015374|Ga0132255_101156982 | Not Available | 1164 | Open in IMG/M |
| 3300015374|Ga0132255_101319919 | Not Available | 1088 | Open in IMG/M |
| 3300016387|Ga0182040_11676018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300016422|Ga0182039_10795153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300018028|Ga0184608_10054716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1581 | Open in IMG/M |
| 3300018031|Ga0184634_10338598 | Not Available | 690 | Open in IMG/M |
| 3300018053|Ga0184626_10400788 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300018054|Ga0184621_10038991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1550 | Open in IMG/M |
| 3300018081|Ga0184625_10196007 | Not Available | 1058 | Open in IMG/M |
| 3300018476|Ga0190274_10981109 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300018476|Ga0190274_11767442 | Not Available | 713 | Open in IMG/M |
| 3300019263|Ga0184647_1065848 | Not Available | 561 | Open in IMG/M |
| 3300019361|Ga0173482_10106562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300019361|Ga0173482_10171282 | Not Available | 865 | Open in IMG/M |
| 3300020016|Ga0193696_1037597 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300020199|Ga0179592_10299189 | Not Available | 715 | Open in IMG/M |
| 3300020581|Ga0210399_10593833 | Not Available | 916 | Open in IMG/M |
| 3300021168|Ga0210406_10155740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1915 | Open in IMG/M |
| 3300021478|Ga0210402_10548138 | Not Available | 1073 | Open in IMG/M |
| 3300025915|Ga0207693_10738448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 761 | Open in IMG/M |
| 3300025929|Ga0207664_10421828 | Not Available | 1188 | Open in IMG/M |
| 3300025931|Ga0207644_10195660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1592 | Open in IMG/M |
| 3300025931|Ga0207644_10341872 | Not Available | 1214 | Open in IMG/M |
| 3300025938|Ga0207704_10288345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
| 3300026693|Ga0208709_104965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300027603|Ga0209331_1032972 | Not Available | 1331 | Open in IMG/M |
| 3300027635|Ga0209625_1124446 | Not Available | 578 | Open in IMG/M |
| 3300027655|Ga0209388_1106930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300027873|Ga0209814_10533240 | Not Available | 521 | Open in IMG/M |
| 3300027909|Ga0209382_10073807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4029 | Open in IMG/M |
| 3300027909|Ga0209382_11603847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 190 | 643 | Open in IMG/M |
| 3300028047|Ga0209526_10575677 | Not Available | 724 | Open in IMG/M |
| 3300028047|Ga0209526_10681030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300028768|Ga0307280_10420247 | Not Available | 501 | Open in IMG/M |
| 3300028784|Ga0307282_10209286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 933 | Open in IMG/M |
| 3300028787|Ga0307323_10275269 | Not Available | 606 | Open in IMG/M |
| 3300028875|Ga0307289_10271723 | Not Available | 697 | Open in IMG/M |
| 3300031720|Ga0307469_10224957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1487 | Open in IMG/M |
| 3300031740|Ga0307468_100323862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1134 | Open in IMG/M |
| 3300032174|Ga0307470_10026505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2698 | Open in IMG/M |
| 3300032180|Ga0307471_103917060 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.36% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.91% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005146 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026693 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN595 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_05466740 | 2124908045 | Soil | MATKEHKPFGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| cont_0681.00006110 | 2166559005 | Simulated | MATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRT |
| E1_04650450 | 2170459002 | Grass Soil | MATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEINVR |
| E4A_08747840 | 2170459003 | Grass Soil | MATKEYNPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK |
| NODE_073216711 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MVTKEYRPLGPKASKAIKFTDWLVEVAYVCESCGTEIKRTIREK* |
| JGI12630J15595_100866251 | 3300001545 | Forest Soil | MATKEYXPMEPKARKAIKFTDSLVEVVYLCESCGTEIKRTIREN* |
| JGI12627J18819_100859441 | 3300001867 | Forest Soil | MATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTETKRTIREK* |
| JGIcombinedJ26739_1002291072 | 3300002245 | Forest Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREN* |
| JGIcombinedJ26739_1003391463 | 3300002245 | Forest Soil | MATKEHKPMGPEQCKAIRFTDSLVEVAYVCESCGTEIKRTIRK* |
| JGI25614J43888_100048515 | 3300002906 | Grasslands Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRET* |
| Ga0062593_1008304841 | 3300004114 | Soil | MATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTIREN* |
| Ga0063356_1060661072 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0062592_1010367322 | 3300004480 | Soil | MATKEHKPMEPKARKAIKFSDSLVEVVYICESCGTEIKRTIREK* |
| Ga0066817_10038642 | 3300005146 | Soil | MATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0066821_10031573 | 3300005147 | Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK* |
| Ga0066685_109688931 | 3300005180 | Soil | KEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK* |
| Ga0070674_1000886303 | 3300005356 | Miscanthus Rhizosphere | MATKEHKPLGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0070709_102601142 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKEYSPTEPKARKAVKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0070713_1009285913 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RMATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIRK* |
| Ga0070705_1010834411 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKEYNPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0070708_1001131346 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0070706_1007715411 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIRK* |
| Ga0070695_1017678921 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0070664_1017853552 | 3300005564 | Corn Rhizosphere | MATKEYKPMEPKARKPIKFTDSLVEVVYICESCGT |
| Ga0070702_1011849781 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRT |
| Ga0068866_106278901 | 3300005718 | Miscanthus Rhizosphere | MATKEHKPVGSKQRKAIKFSDSLVEIAYVCESCGTEIKRT |
| Ga0068863_1006201982 | 3300005841 | Switchgrass Rhizosphere | MATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTILEN* |
| Ga0070717_106775961 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIRK* |
| Ga0070717_121605571 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0075365_102017362 | 3300006038 | Populus Endosphere | ICPRCRRRMVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0075365_107318392 | 3300006038 | Populus Endosphere | MATKEHKPFGPKQRKAIKFSDGLVEVAYVCESCGTEIKRTIREK* |
| Ga0075417_104475081 | 3300006049 | Populus Rhizosphere | MATKEHKPMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIREN* |
| Ga0070712_1003939333 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKEYSPTEPKARKAIKFSDTLVEVAYVCESCGTEIKRTIREK* |
| Ga0074047_119029262 | 3300006576 | Soil | MATKEHKPVGPKQRKAIKFSDSLVDVAYVCESCGTEIKRTIREK* |
| Ga0066658_107989722 | 3300006794 | Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTE |
| Ga0075428_1003892112 | 3300006844 | Populus Rhizosphere | MVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0075424_1007558153 | 3300006904 | Populus Rhizosphere | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREQ* |
| Ga0075418_105336452 | 3300009100 | Populus Rhizosphere | MVTKEYRPLGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0075418_110364882 | 3300009100 | Populus Rhizosphere | MGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0075418_122079121 | 3300009100 | Populus Rhizosphere | MVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIR |
| Ga0099792_109144151 | 3300009143 | Vadose Zone Soil | KEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRET* |
| Ga0114129_127645942 | 3300009147 | Populus Rhizosphere | MVTKEYRPMGPKARKAIKFTDSLVEVAYVCENCGAEIKRTIRES* |
| Ga0105242_127863411 | 3300009176 | Miscanthus Rhizosphere | PVGPNQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0105238_117638191 | 3300009551 | Corn Rhizosphere | MATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIK |
| Ga0126313_106046271 | 3300009840 | Serpentine Soil | MATKDHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0134128_110537513 | 3300010373 | Terrestrial Soil | MATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKHTIREN* |
| Ga0134127_103563221 | 3300010399 | Terrestrial Soil | MATKEHKPVGSKQRKAIKFSDSLVEIAYVCESCGTEIKRTIREK* |
| Ga0134123_136491432 | 3300010403 | Terrestrial Soil | EPKARKAVKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0150983_125395121 | 3300011120 | Forest Soil | MATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTE |
| Ga0120191_101602352 | 3300012022 | Terrestrial | MVTKEYRPRGPIARKAIKFTDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0137388_1001533910 | 3300012189 | Vadose Zone Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRE |
| Ga0137362_111848811 | 3300012205 | Vadose Zone Soil | MATKEHKPMGPEQHKAIRFTDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0137370_109675361 | 3300012285 | Vadose Zone Soil | MVTKEYRPGPETSKAITFTDSLVEVAYVCESCGTEIKRTMREK* |
| Ga0157295_100398602 | 3300012906 | Soil | MATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTIREK* |
| Ga0137359_101012061 | 3300012923 | Vadose Zone Soil | EPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK* |
| Ga0162652_1000684811 | 3300012941 | Soil | RCRRRMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK* |
| Ga0164300_100288514 | 3300012951 | Soil | MATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEI |
| Ga0164298_103561521 | 3300012955 | Soil | MATKEYKPMGPKARKAIKFTDSLVEVVYICESCGTEIK |
| Ga0164298_106406112 | 3300012955 | Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREKARVLCNELA* |
| Ga0164298_109733911 | 3300012955 | Soil | MATKEHRPVGPKQRKAIKFSDSLVEVAYVCDSCGTEIKRTLRERWA* |
| Ga0164309_100965802 | 3300012984 | Soil | MATKEYTPTEPKARKAIKFSDSLVEVAYVCESCGTEIKR |
| Ga0164308_107615052 | 3300012985 | Soil | ATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0164308_121816851 | 3300012985 | Soil | MATKEYKPMEPKARKAIKFSDSLVEVVYICESCGTEIKRTIREK* |
| Ga0164306_120239502 | 3300012988 | Soil | MATKEYKPMEPKARKAIKFSDSLVEVVYTCESCGTEIKRT |
| Ga0157378_105307401 | 3300013297 | Miscanthus Rhizosphere | RMATKEYNPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREE* |
| Ga0163162_109538581 | 3300013306 | Switchgrass Rhizosphere | MATTEHKPVGPKQRKAIKFSDGLVEVAYVCESCGTEIKRTIREK |
| Ga0173483_107559852 | 3300015077 | Soil | RMATKEHKPLGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0132258_1005170010 | 3300015371 | Arabidopsis Rhizosphere | MVTKEYRPRGPKARKDIKFTDSLVEVAYVCENCGTEIKRTIRET* |
| Ga0132255_1007301291 | 3300015374 | Arabidopsis Rhizosphere | MATKEHKPMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIREK* |
| Ga0132255_1011569821 | 3300015374 | Arabidopsis Rhizosphere | ATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTILEN* |
| Ga0132255_1013199193 | 3300015374 | Arabidopsis Rhizosphere | MVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIRGK* |
| Ga0182040_116760181 | 3300016387 | Soil | TKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK |
| Ga0182039_107951531 | 3300016422 | Soil | WPRCRRRMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK |
| Ga0184608_100547162 | 3300018028 | Groundwater Sediment | MATKEYNPMGPKQRKAIKFTDRLVEVAYVCESCGTEIKRTIREK |
| Ga0184634_103385982 | 3300018031 | Groundwater Sediment | PVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0184626_104007882 | 3300018053 | Groundwater Sediment | PRCRRRMATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0184621_100389912 | 3300018054 | Groundwater Sediment | MATKEHNPMGPKQRKVIKFTDRLVEVAYVCESCGTEIKRTIREK |
| Ga0184625_101960073 | 3300018081 | Groundwater Sediment | CPRCRRRMATKEYNPMGPKQRKAIKFTDRLVEVAYVCESCGTEIKRTIREK |
| Ga0190274_109811091 | 3300018476 | Soil | MATKDHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0190274_117674422 | 3300018476 | Soil | MATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKR |
| Ga0184647_10658483 | 3300019263 | Groundwater Sediment | MATKEHRPTGPKARKAIKFSDSLVEVAYICDSCGTEIK |
| Ga0173482_101065621 | 3300019361 | Soil | MATKEHKPMEPKARKAIKFSDSLVEVVYICESCGT |
| Ga0173482_101712821 | 3300019361 | Soil | MATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTIREN |
| Ga0193696_10375973 | 3300020016 | Soil | MATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0179592_102991891 | 3300020199 | Vadose Zone Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRET |
| Ga0210399_105938331 | 3300020581 | Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKR |
| Ga0210406_101557403 | 3300021168 | Soil | MATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0210402_105481382 | 3300021478 | Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYLCESCGTEIKRTIREN |
| Ga0207693_107384482 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RRRMATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0207664_104218281 | 3300025929 | Agricultural Soil | CLACPTEPKARKAVKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0207644_101956601 | 3300025931 | Switchgrass Rhizosphere | MATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTILEN |
| Ga0207644_103418722 | 3300025931 | Switchgrass Rhizosphere | RCRRRMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK |
| Ga0207704_102883452 | 3300025938 | Miscanthus Rhizosphere | EHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0208709_1049652 | 3300026693 | Soil | RMATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIREK |
| Ga0209331_10329722 | 3300027603 | Forest Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREN |
| Ga0209625_11244462 | 3300027635 | Forest Soil | MATKEYNPMEPKARKAIKFTDSLVEVVYLCESCGTEIKRTIREK |
| Ga0209388_11069303 | 3300027655 | Vadose Zone Soil | KPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRET |
| Ga0209814_105332401 | 3300027873 | Populus Rhizosphere | MATKEHKPMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIREN |
| Ga0209382_100738074 | 3300027909 | Populus Rhizosphere | MVTKEYRPLGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK |
| Ga0209382_116038472 | 3300027909 | Populus Rhizosphere | ATKEHKPMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIRESRPP |
| Ga0209526_105756773 | 3300028047 | Forest Soil | MATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIK |
| Ga0209526_106810302 | 3300028047 | Forest Soil | MATKEHKPMGPEQCKAIRFTDSLVEVAYVCESCGTEIKRTIRK |
| Ga0307280_104202471 | 3300028768 | Soil | MATKEYSPTEPKARKAIKFSDTLVEVAYVCESCGTEIKRTIRE |
| Ga0307282_102092861 | 3300028784 | Soil | KEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0307323_102752691 | 3300028787 | Soil | MATKEYSPTEPKARKAIKFSDTLVEVAYVCESCGTEIKRTIREK |
| Ga0307289_102717231 | 3300028875 | Soil | MATKEHRPTGPKARKAIKFSDSLVEVAYVCDSCGTEIKRTLRER |
| Ga0307469_102249571 | 3300031720 | Hardwood Forest Soil | MVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK |
| Ga0307468_1003238621 | 3300031740 | Hardwood Forest Soil | VICPRCRRRMVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK |
| Ga0307470_100265053 | 3300032174 | Hardwood Forest Soil | MEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK |
| Ga0307471_1039170601 | 3300032180 | Hardwood Forest Soil | MATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREQ |
| ⦗Top⦘ |