


| Basic Information | |
|---|---|
| Family ID | F087545 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.94 % |
| % of genes near scaffold ends (potentially truncated) | 95.45 % |
| % of genes from short scaffolds (< 2000 bps) | 88.18 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF16917 | BPL_LplA_LipB_2 | 24.55 |
| PF03401 | TctC | 1.82 |
| PF12727 | PBP_like | 1.82 |
| PF13187 | Fer4_9 | 0.91 |
| PF01047 | MarR | 0.91 |
| PF09278 | MerR-DNA-bind | 0.91 |
| PF03466 | LysR_substrate | 0.91 |
| PF00903 | Glyoxalase | 0.91 |
| PF12840 | HTH_20 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.82 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.09 % |
| Unclassified | root | N/A | 20.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402GFK3I | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300000956|JGI10216J12902_106317959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300004633|Ga0066395_10669962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300005164|Ga0066815_10055647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300005332|Ga0066388_101350162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1234 | Open in IMG/M |
| 3300005339|Ga0070660_101589617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300005406|Ga0070703_10299216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300005713|Ga0066905_100757534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300005764|Ga0066903_105918099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300006051|Ga0075364_10490633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 840 | Open in IMG/M |
| 3300006057|Ga0075026_100429599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 748 | Open in IMG/M |
| 3300006057|Ga0075026_101075870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300006175|Ga0070712_101155448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300006177|Ga0075362_10741326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300006177|Ga0075362_10767111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300006196|Ga0075422_10372007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 627 | Open in IMG/M |
| 3300006880|Ga0075429_101329203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300009088|Ga0099830_10003075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9042 | Open in IMG/M |
| 3300009090|Ga0099827_10395611 | Not Available | 1180 | Open in IMG/M |
| 3300009176|Ga0105242_13070087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300010043|Ga0126380_11781428 | Not Available | 556 | Open in IMG/M |
| 3300010046|Ga0126384_10865211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300010046|Ga0126384_12160864 | Not Available | 535 | Open in IMG/M |
| 3300010047|Ga0126382_10410674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
| 3300010047|Ga0126382_12014106 | Not Available | 550 | Open in IMG/M |
| 3300010303|Ga0134082_10206264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300010358|Ga0126370_11187678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300010360|Ga0126372_10879025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300010361|Ga0126378_12781653 | Not Available | 559 | Open in IMG/M |
| 3300010361|Ga0126378_12922721 | Not Available | 545 | Open in IMG/M |
| 3300012096|Ga0137389_11845052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300012203|Ga0137399_11416619 | Not Available | 581 | Open in IMG/M |
| 3300012358|Ga0137368_10051685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3479 | Open in IMG/M |
| 3300012958|Ga0164299_11063484 | Not Available | 602 | Open in IMG/M |
| 3300012958|Ga0164299_11368426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 545 | Open in IMG/M |
| 3300012971|Ga0126369_10475893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1303 | Open in IMG/M |
| 3300015372|Ga0132256_100273580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1765 | Open in IMG/M |
| 3300016319|Ga0182033_10280301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1367 | Open in IMG/M |
| 3300016341|Ga0182035_10603981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 948 | Open in IMG/M |
| 3300016404|Ga0182037_10370377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1172 | Open in IMG/M |
| 3300018073|Ga0184624_10426895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300018077|Ga0184633_10536212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300018422|Ga0190265_12592429 | Not Available | 605 | Open in IMG/M |
| 3300018465|Ga0190269_10007990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4774 | Open in IMG/M |
| 3300018465|Ga0190269_10671412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300019362|Ga0173479_10529907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300021073|Ga0210378_10148917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 904 | Open in IMG/M |
| 3300021344|Ga0193719_10202581 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300021560|Ga0126371_11959063 | Not Available | 704 | Open in IMG/M |
| 3300025919|Ga0207657_11176001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300025927|Ga0207687_11184006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300025937|Ga0207669_10920844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300026304|Ga0209240_1124125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| 3300026310|Ga0209239_1375336 | Not Available | 500 | Open in IMG/M |
| 3300026334|Ga0209377_1309124 | Not Available | 527 | Open in IMG/M |
| 3300026356|Ga0257150_1075489 | Not Available | 512 | Open in IMG/M |
| 3300026482|Ga0257172_1024639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1071 | Open in IMG/M |
| 3300026489|Ga0257160_1102694 | Not Available | 515 | Open in IMG/M |
| 3300027610|Ga0209528_1112151 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300027862|Ga0209701_10477874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 681 | Open in IMG/M |
| 3300027866|Ga0209813_10060488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1208 | Open in IMG/M |
| 3300027874|Ga0209465_10141705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1191 | Open in IMG/M |
| 3300027874|Ga0209465_10438269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300027882|Ga0209590_10432874 | Not Available | 850 | Open in IMG/M |
| 3300027903|Ga0209488_10152276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1746 | Open in IMG/M |
| 3300028047|Ga0209526_10528379 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300028707|Ga0307291_1056913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300028755|Ga0307316_10235591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300031549|Ga0318571_10127745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 859 | Open in IMG/M |
| 3300031549|Ga0318571_10323279 | Not Available | 585 | Open in IMG/M |
| 3300031561|Ga0318528_10628431 | Not Available | 575 | Open in IMG/M |
| 3300031561|Ga0318528_10708224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300031640|Ga0318555_10510505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300031668|Ga0318542_10098470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 1408 | Open in IMG/M |
| 3300031680|Ga0318574_10185669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1191 | Open in IMG/M |
| 3300031744|Ga0306918_10911292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300031747|Ga0318502_10186377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1196 | Open in IMG/M |
| 3300031748|Ga0318492_10410895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
| 3300031748|Ga0318492_10411655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300031770|Ga0318521_10022342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2975 | Open in IMG/M |
| 3300031770|Ga0318521_10028491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2709 | Open in IMG/M |
| 3300031771|Ga0318546_11114069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300031777|Ga0318543_10226782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 831 | Open in IMG/M |
| 3300031798|Ga0318523_10031708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 2398 | Open in IMG/M |
| 3300031819|Ga0318568_10516711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300031833|Ga0310917_10023556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3567 | Open in IMG/M |
| 3300031833|Ga0310917_10641175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300031833|Ga0310917_10818365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300031879|Ga0306919_10146449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1718 | Open in IMG/M |
| 3300031880|Ga0318544_10183070 | Not Available | 807 | Open in IMG/M |
| 3300031912|Ga0306921_11149135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 867 | Open in IMG/M |
| 3300031912|Ga0306921_11677813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300031941|Ga0310912_10003035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9702 | Open in IMG/M |
| 3300031941|Ga0310912_10320380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1201 | Open in IMG/M |
| 3300031942|Ga0310916_10326484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1302 | Open in IMG/M |
| 3300031944|Ga0310884_11085554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300031954|Ga0306926_11356490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300031954|Ga0306926_11559551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300032025|Ga0318507_10225336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 811 | Open in IMG/M |
| 3300032035|Ga0310911_10557790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300032039|Ga0318559_10142993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 1083 | Open in IMG/M |
| 3300032068|Ga0318553_10061912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1860 | Open in IMG/M |
| 3300032090|Ga0318518_10027017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2592 | Open in IMG/M |
| 3300032090|Ga0318518_10684031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 522 | Open in IMG/M |
| 3300032174|Ga0307470_10367271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1005 | Open in IMG/M |
| 3300032261|Ga0306920_101468662 | Not Available | 975 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.45% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08344340 | 2189573004 | Grass Soil | LAPSFIYSIVSTPNAFAERIRVETMKWGRVIREANVKVE |
| JGI10216J12902_1063179592 | 3300000956 | Soil | FRDKFLTPNFIFPIVSSQEAFAERIRRESEKWGKVIRDANVKVE* |
| Ga0066395_106699621 | 3300004633 | Tropical Forest Soil | EKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE* |
| Ga0066815_100556471 | 3300005164 | Soil | REKFLAPNFIFSIVSSPEAFAERIRRESAKWGKVIRDANIKAE* |
| Ga0066388_1013501621 | 3300005332 | Tropical Forest Soil | KFLAPNVIFSIAGPPEQFADRIRVDYAKWGKVIRDANVKVE* |
| Ga0070660_1015896172 | 3300005339 | Corn Rhizosphere | FLAPNFIFPIVSPPEEFAERIRRESEKWGKVIRDANVKVE* |
| Ga0070703_102992161 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | FLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE* |
| Ga0066905_1007575341 | 3300005713 | Tropical Forest Soil | PAFRDKFLAPNFIFSVVSSPDAFAQRIRSESAKWGQVIRDANVRVE* |
| Ga0066903_1059180992 | 3300005764 | Tropical Forest Soil | APNFIFSIVSSPEAFAERIRLESAKWGKVIRGANIKAE* |
| Ga0075364_104906331 | 3300006051 | Populus Endosphere | IFSVVSSPEAFAERITRESAKWGQVIRDANVRVE* |
| Ga0075026_1004295991 | 3300006057 | Watersheds | FRDRFLAPSFIYSIAGPPDGFAERIRTDLAKWGKVIRETKVQVE* |
| Ga0075026_1010758702 | 3300006057 | Watersheds | PNFIFPIVSSPEAFAERIRRESAKWGKIIRDANVRVE* |
| Ga0070712_1011554481 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPNMIFSIAGSPEEFAARIRTDYVKWGKVIRDANVKVE* |
| Ga0075362_107413261 | 3300006177 | Populus Endosphere | NFIFPIVSAPEAFAERIRRESEKWGKVIRDANVKVE* |
| Ga0075362_107671112 | 3300006177 | Populus Endosphere | DGEDEVRREKFLAPNFIFSVVSSPEAFAERIRLESAKWEQVIRDANVRVE* |
| Ga0075422_103720071 | 3300006196 | Populus Rhizosphere | IFPIVSSPDAFAERIRRESEKWGKVIRDANVRVE* |
| Ga0075429_1013292032 | 3300006880 | Populus Rhizosphere | DKFLAPNFIYSIVSSPEAFAERIRLDSAKWGKVIRDANIKVE* |
| Ga0099830_1000307510 | 3300009088 | Vadose Zone Soil | FIFSIATPPEAFAERIRSESAKWGKVIRDANIKVE* |
| Ga0099827_103956113 | 3300009090 | Vadose Zone Soil | QRIFNEAGFRDRFLTPNFIYSIVSSPEAFAERMRLDSEKWGKVIRAAKVKVE* |
| Ga0105242_130700872 | 3300009176 | Miscanthus Rhizosphere | DDPTFRDKFLTPNFIFPIVTSQEAFAERIRRESEKWGKVIRDANVKVE* |
| Ga0103869_100501403 | 3300009257 | River Water | VGFVALGSSPEELAAVMRSDLAKWGKVIRANNIKPE* |
| Ga0126380_117814282 | 3300010043 | Tropical Forest Soil | LAPNFIFSIVSSPEAFAERIRLESAKWGKVIHDANIKAE* |
| Ga0126384_108652111 | 3300010046 | Tropical Forest Soil | FREKFLAPNFIFSIVSSPEAFAERIRRESAKWGKVIRDANIRAE* |
| Ga0126384_121608642 | 3300010046 | Tropical Forest Soil | REKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE* |
| Ga0126382_104106741 | 3300010047 | Tropical Forest Soil | FINSIVSSPEDFGARIRADSAKWGKVIRDASIKAE* |
| Ga0126382_120141062 | 3300010047 | Tropical Forest Soil | KFLTPNFIFSIASAPEAFAERIRMESGKWGKVIRDANLKAE* |
| Ga0134082_102062642 | 3300010303 | Grasslands Soil | FLAPNFIFSITSSPEAFAERIRIESAKWGKLIRDANLKAE* |
| Ga0126370_111876781 | 3300010358 | Tropical Forest Soil | KFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRGANIKAE* |
| Ga0126376_103263621 | 3300010359 | Tropical Forest Soil | SFIDSIVSSPEDFAARIRADSAKWGKVIRAANIKAE* |
| Ga0126376_113414871 | 3300010359 | Tropical Forest Soil | RDRVLAPSCIYSIDSSPEEFTARIRSDSAKWGKVIREANIKAE* |
| Ga0126372_108790251 | 3300010360 | Tropical Forest Soil | IFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE* |
| Ga0126378_127816532 | 3300010361 | Tropical Forest Soil | EKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIHDANIKAE* |
| Ga0126378_129227212 | 3300010361 | Tropical Forest Soil | EKFLAPNFIFSIVSPPEAFAERIRLESAKWGKVIRDANIKVE* |
| Ga0126377_109588833 | 3300010362 | Tropical Forest Soil | PVLRDRVLAPSFIYSIASSPEQFTARIQSDSAKWGKVIREANIKAE* |
| Ga0137389_118450522 | 3300012096 | Vadose Zone Soil | GFREKFLASNFIYSIVSSPEAFAERIRLDSAKWGKVIRDAGVKVE* |
| Ga0137399_114166191 | 3300012203 | Vadose Zone Soil | IFPIVSSPEAFAERIRRESAKWGKIIRDANVRVE* |
| Ga0137368_100516851 | 3300012358 | Vadose Zone Soil | PNFIFSITSSPEAFAERIRIESAKWGKLIRDANLKAE* |
| Ga0164299_110634842 | 3300012958 | Soil | PSFIFSIASAPEVFAARIRSEWAKWGEVIRDAGLEPE* |
| Ga0164299_113684261 | 3300012958 | Soil | FIFPIVSSPETFAERIRRESEKWGKVIRDANVKVE* |
| Ga0126369_104758931 | 3300012971 | Tropical Forest Soil | EKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRGANIKAE* |
| Ga0132256_1002735801 | 3300015372 | Arabidopsis Rhizosphere | IFPIVTSQEAFAERIRRESEKWGKVIRDANVKVE* |
| Ga0182033_102803011 | 3300016319 | Soil | AFREKFLAPNFIFSIVSSPEVFAERIRLESAKWGKVIRDANIKAE |
| Ga0182035_106039811 | 3300016341 | Soil | LTPNFIFSIVSSPEAFAQRIRSESAKWGKVIRDAGVKIE |
| Ga0182037_103703771 | 3300016404 | Soil | REKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0184624_104268952 | 3300018073 | Groundwater Sediment | FRDKFLAPNFIYSIVSSPEAFAERVRLDSAKWGKVIRDANIKVE |
| Ga0184633_105362121 | 3300018077 | Groundwater Sediment | AFREKFLAPNFIFPNVSSPEAFAERIRRESAKWGKIIRDANVRVE |
| Ga0190265_125924291 | 3300018422 | Soil | VLEPSFIFSIASSPDDFAERMKRDSIKWGKVIRDANIKAE |
| Ga0190269_100079901 | 3300018465 | Soil | TQKIFNDPAFQEKYLAKSFIFSIASSPATFAERLRADSERWGKVIRDAKVKVE |
| Ga0190269_106714122 | 3300018465 | Soil | FIFPIVSSQEAFAERIRRESEKWGKVIRDANVKVE |
| Ga0173479_105299072 | 3300019362 | Soil | FLTPNFIFSIVSSPDAFAERIRRESEKWGKVIRDANVRVE |
| Ga0210378_101489173 | 3300021073 | Groundwater Sediment | GFRDKFLAPNFIYSIVSSPEAFAERIRLDSAKWGKVIRDANIKVE |
| Ga0193719_102025811 | 3300021344 | Soil | ETQRIFSDAQFREKILAPNFIYSIVSPPAVFAERIRLETAKWGKIIREANVKVE |
| Ga0126371_119590632 | 3300021560 | Tropical Forest Soil | LAPNFIFSIVSPPDAFAKRIRAESAKWGKLIRDTGLKME |
| Ga0207657_111760011 | 3300025919 | Corn Rhizosphere | FLAPNFIFPIVSPPEEFAERIRRESEKWGKVIRDANVKVE |
| Ga0207687_111840062 | 3300025927 | Miscanthus Rhizosphere | FLTPNFIFPIVSSQEAFAERIRRESEKWGKVIRDANVKVE |
| Ga0207669_109208442 | 3300025937 | Miscanthus Rhizosphere | RDKFLTPNFIFSIVSSPDAFAERIRRESEKWGKVIRDANVRVE |
| Ga0209240_11241252 | 3300026304 | Grasslands Soil | MIFSIAGSPEEFAARIRTDHAKWGKVIRDANVKVE |
| Ga0209239_13753362 | 3300026310 | Grasslands Soil | LAPNFIFSIVSSPEAFAERIRRESAKWGKVIRDANIKAE |
| Ga0209377_13091242 | 3300026334 | Soil | FLTPNFIFPIVSPPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0257150_10754891 | 3300026356 | Soil | FLAPNFIFSIVSSPEAFAERIRRESAKWGKVIRDANIKAE |
| Ga0257172_10246393 | 3300026482 | Soil | EKFLAPNFIFSIVSSPEAFAERIRRESAKWGKVIRDANIKAE |
| Ga0257160_11026941 | 3300026489 | Soil | FRDRVLAPSFIYSIASSPEQFTARIQSDSAKWGKVIREANIKAE |
| Ga0209528_11121511 | 3300027610 | Forest Soil | TVLAPNFIFSIASAPEVFAARIRLEWAKWGEVIRDAGLKPE |
| Ga0209701_104778742 | 3300027862 | Vadose Zone Soil | FREKFLAPRFIFPIVSSPEEFAERVRTESAKWGKVIKDAN |
| Ga0209813_100604881 | 3300027866 | Populus Endosphere | FLTPNFIFPIVSSPEGFAERIRRESEKWGKVIRDANVRVE |
| Ga0209465_101417053 | 3300027874 | Tropical Forest Soil | FLAPNFIFSIVSSPEAFAERIRLESAKWGKVIHDANIKAE |
| Ga0209465_104382691 | 3300027874 | Tropical Forest Soil | FLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0209590_104328742 | 3300027882 | Vadose Zone Soil | APNFIYSIVSSPEAFAERMRLDSEKWGKVIRAAKVKVE |
| Ga0209488_101522761 | 3300027903 | Vadose Zone Soil | IFDDSAFRDKFLAPNFIFPIVSSPEAFAERIRRESATWGKIIRDANVRVE |
| Ga0209526_105283793 | 3300028047 | Forest Soil | RDRYLAPAATFSIASSPEAFAERIAHDSARWGKVIRAAGIKVN |
| Ga0307291_10569131 | 3300028707 | Soil | APNFIFPIVSSPEAFAERIRRESAKWGKIIRDANVRVE |
| Ga0307316_102355911 | 3300028755 | Soil | FIFPIVSSPEAFAERIRRESAKWGKIIRDANVRVE |
| Ga0318571_101277451 | 3300031549 | Soil | KFLAPNFIFSVTSSSEAFAERIRLESAKWREVIRNANVKVE |
| Ga0318571_103232792 | 3300031549 | Soil | LAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDAHIKAE |
| Ga0318528_106284312 | 3300031561 | Soil | EKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0318528_107082242 | 3300031561 | Soil | RIFNDPAFRDKFLTPNFIFSIVSSPEAFAQRIRSESAKWGKVIRDAGVKIE |
| Ga0318555_105105052 | 3300031640 | Soil | LAPNSIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0318542_100984703 | 3300031668 | Soil | REKFLAPNFIFSIVSPPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0318574_101856692 | 3300031680 | Soil | FLNAQTRRIFEDASFREQFLTPNFIFSIVSPADAFAERIRSESAKWGKLIRDTGLKVE |
| Ga0306918_109112922 | 3300031744 | Soil | FREKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRGANIKAE |
| Ga0318502_101863773 | 3300031747 | Soil | SFREKFLAPNSIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0318492_104108952 | 3300031748 | Soil | PNFIFSIVSSPEAFAERIRLESAKWGKVIRGANIKAE |
| Ga0318492_104116552 | 3300031748 | Soil | AFREKFLAPNFIFPIVSSPEAFAERIRLESAKWGKVIRDAHIKVE |
| Ga0318521_100223424 | 3300031770 | Soil | PNFIFSIVSSPEVFAERIRLESAKWGKVIRDANIKAE |
| Ga0318521_100284914 | 3300031770 | Soil | NFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0318546_111140691 | 3300031771 | Soil | APSFIYSIVSSPDAFAERIRVESAKWGKVIKDANVKVE |
| Ga0318543_102267821 | 3300031777 | Soil | FLAPNFIFSIVSPPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0318523_100317084 | 3300031798 | Soil | FREKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDAHIKAE |
| Ga0318568_105167112 | 3300031819 | Soil | AFREKFLTPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0310917_100235564 | 3300031833 | Soil | SFREQFLTPNFIFSIVSPADAFAERIRSESAKWGKLIRDTGLKVE |
| Ga0310917_106411751 | 3300031833 | Soil | GELTIEKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRGANIKAE |
| Ga0310917_108183652 | 3300031833 | Soil | KFLAPNSIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0306919_101464494 | 3300031879 | Soil | FREKFLAPNFIFSVTSLSEAFAERIRLESAKWREVIRNANVKVE |
| Ga0318544_101830701 | 3300031880 | Soil | RRIFEDASFREQFLTPNFIFSIVSPADAFAERIRSESAKWGKLIRDTGLKVE |
| Ga0306921_111491351 | 3300031912 | Soil | REKFLTPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0306921_116778132 | 3300031912 | Soil | QTRRIFEDASFREQFLTPNFIFSIVSPPEAFAERIRSESVKWERLIRDTGLKME |
| Ga0310912_1000303510 | 3300031941 | Soil | FREKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0310912_103203803 | 3300031941 | Soil | REKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRGANIKAE |
| Ga0310916_103264843 | 3300031942 | Soil | PAFRDKFLTPNFIFSIVSSPEAFAQRIRSESAKWGKVIRDAGVKIE |
| Ga0310884_110855542 | 3300031944 | Soil | NFIFPIVSSPDAFAERIRRESEKWGKVIRDANVRVE |
| Ga0306926_113564901 | 3300031954 | Soil | FREKFLAPNFIFSIVSSPEAFAERIRLESAKWGKVIRDAKIKAE |
| Ga0306926_115595511 | 3300031954 | Soil | TPNFIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0318507_102253361 | 3300032025 | Soil | FIFSIVSPPDVFAERIRAESTKWGKLIRDTGLKIE |
| Ga0310911_105577902 | 3300032035 | Soil | FREKFLAPNSIFSIVSSPEAFAERIRLESAKWGKVIRDANIKAE |
| Ga0318559_101429933 | 3300032039 | Soil | PNFIFSVTSSSEAFAERIRLESAKWREVIRNANVKVE |
| Ga0318553_100619121 | 3300032068 | Soil | DEPSFREQFLAPNFIFSIVSPPDVFAERIRAESAKWGKLIRDTGLKVE |
| Ga0318518_100270174 | 3300032090 | Soil | FLAPNFIFSIVSAPEAFAERIRSESAKWGKIIRDANVKAE |
| Ga0318518_106840312 | 3300032090 | Soil | VNLLNAQTRRIFEDASFREQFLTPNFIFSIVSPPEAFAERIRSESVKWERLIRDTGLKME |
| Ga0307470_103672713 | 3300032174 | Hardwood Forest Soil | PNFIFSVVSSPEAFAERIRRESAKWGQVIRDANVKVE |
| Ga0306920_1014686621 | 3300032261 | Soil | LAPAATFSIASSPEAFAERIAQDSARWGKLIRAAGIKVN |
| ⦗Top⦘ |