


| Basic Information | |
|---|---|
| Family ID | F087540 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEVLMRVRAS |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.29 % |
| % of genes near scaffold ends (potentially truncated) | 74.55 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.909 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF08240 | ADH_N | 12.73 |
| PF13561 | adh_short_C2 | 10.91 |
| PF00596 | Aldolase_II | 9.09 |
| PF00106 | adh_short | 4.55 |
| PF00107 | ADH_zinc_N | 1.82 |
| PF10861 | DUF2784 | 0.91 |
| PF00496 | SBP_bac_5 | 0.91 |
| PF00034 | Cytochrom_C | 0.91 |
| PF13610 | DDE_Tnp_IS240 | 0.91 |
| PF05019 | Coq4 | 0.91 |
| PF07386 | DUF1499 | 0.91 |
| PF00043 | GST_C | 0.91 |
| PF03237 | Terminase_6N | 0.91 |
| PF02586 | SRAP | 0.91 |
| PF12706 | Lactamase_B_2 | 0.91 |
| PF07969 | Amidohydro_3 | 0.91 |
| PF00313 | CSD | 0.91 |
| PF14534 | DUF4440 | 0.91 |
| PF07690 | MFS_1 | 0.91 |
| PF03928 | HbpS-like | 0.91 |
| PF12833 | HTH_18 | 0.91 |
| PF15902 | Sortilin-Vps10 | 0.91 |
| PF00561 | Abhydrolase_1 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.91 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.91 |
| COG4446 | Uncharacterized conserved protein, DUF1499 family | Function unknown [S] | 0.91 |
| COG5031 | Ubiquinone biosynthesis protein Coq4 | Coenzyme transport and metabolism [H] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.91 % |
| Unclassified | root | N/A | 39.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005176|Ga0066679_10372984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300005332|Ga0066388_105024958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → Janthinobacterium agaricidamnosum | 672 | Open in IMG/M |
| 3300005332|Ga0066388_108151346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300005437|Ga0070710_11436164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300005610|Ga0070763_10925284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300005713|Ga0066905_101438841 | Not Available | 625 | Open in IMG/M |
| 3300005764|Ga0066903_103417752 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005764|Ga0066903_104192039 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300006050|Ga0075028_100808765 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006175|Ga0070712_101294808 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006954|Ga0079219_10101098 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300007255|Ga0099791_10541612 | Not Available | 567 | Open in IMG/M |
| 3300007788|Ga0099795_10531453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11 | 552 | Open in IMG/M |
| 3300009089|Ga0099828_11525231 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009792|Ga0126374_10694190 | Not Available | 764 | Open in IMG/M |
| 3300010046|Ga0126384_11179092 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 706 | Open in IMG/M |
| 3300010048|Ga0126373_10033500 | Not Available | 4462 | Open in IMG/M |
| 3300010326|Ga0134065_10310465 | Not Available | 607 | Open in IMG/M |
| 3300010341|Ga0074045_10105821 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300010358|Ga0126370_11220629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300010361|Ga0126378_10161222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2293 | Open in IMG/M |
| 3300010366|Ga0126379_12094325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 668 | Open in IMG/M |
| 3300010376|Ga0126381_102797948 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300011269|Ga0137392_11622580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300011271|Ga0137393_10749100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300011410|Ga0137440_1097144 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012096|Ga0137389_11225661 | Not Available | 643 | Open in IMG/M |
| 3300012203|Ga0137399_11089390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300012203|Ga0137399_11101666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 669 | Open in IMG/M |
| 3300012205|Ga0137362_10377490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1228 | Open in IMG/M |
| 3300012208|Ga0137376_10746583 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012361|Ga0137360_11605869 | Not Available | 555 | Open in IMG/M |
| 3300012923|Ga0137359_11171817 | Not Available | 656 | Open in IMG/M |
| 3300012927|Ga0137416_11574830 | Not Available | 598 | Open in IMG/M |
| 3300012929|Ga0137404_11565142 | Not Available | 611 | Open in IMG/M |
| 3300012971|Ga0126369_11776339 | Not Available | 705 | Open in IMG/M |
| 3300016270|Ga0182036_10290342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
| 3300016270|Ga0182036_10341494 | Not Available | 1151 | Open in IMG/M |
| 3300016270|Ga0182036_10452335 | Not Available | 1010 | Open in IMG/M |
| 3300016270|Ga0182036_11064265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 669 | Open in IMG/M |
| 3300016294|Ga0182041_11423119 | Not Available | 637 | Open in IMG/M |
| 3300016357|Ga0182032_10583077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300016357|Ga0182032_10916621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 745 | Open in IMG/M |
| 3300016387|Ga0182040_11964823 | Not Available | 502 | Open in IMG/M |
| 3300016404|Ga0182037_10107833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2019 | Open in IMG/M |
| 3300016404|Ga0182037_10134019 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300018468|Ga0066662_12803719 | Not Available | 517 | Open in IMG/M |
| 3300021168|Ga0210406_10854181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300021168|Ga0210406_11271202 | Not Available | 532 | Open in IMG/M |
| 3300021362|Ga0213882_10258924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300021401|Ga0210393_10613806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300021432|Ga0210384_11614366 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300021474|Ga0210390_11309298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300021479|Ga0210410_11553014 | Not Available | 555 | Open in IMG/M |
| 3300021560|Ga0126371_10355510 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300021560|Ga0126371_11033817 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300021560|Ga0126371_13020508 | Not Available | 570 | Open in IMG/M |
| 3300025898|Ga0207692_10461313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300026330|Ga0209473_1325638 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027049|Ga0207806_1042842 | Not Available | 516 | Open in IMG/M |
| 3300027603|Ga0209331_1043831 | Not Available | 1137 | Open in IMG/M |
| 3300027812|Ga0209656_10156542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1137 | Open in IMG/M |
| 3300027855|Ga0209693_10392221 | Not Available | 671 | Open in IMG/M |
| 3300031231|Ga0170824_124974020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1801 | Open in IMG/M |
| 3300031469|Ga0170819_11579150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium larrymoorei | 714 | Open in IMG/M |
| 3300031564|Ga0318573_10408523 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300031572|Ga0318515_10174786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1148 | Open in IMG/M |
| 3300031679|Ga0318561_10091004 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300031682|Ga0318560_10562335 | Not Available | 618 | Open in IMG/M |
| 3300031708|Ga0310686_107095990 | Not Available | 951 | Open in IMG/M |
| 3300031719|Ga0306917_10449596 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300031719|Ga0306917_11464053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300031724|Ga0318500_10160601 | Not Available | 1061 | Open in IMG/M |
| 3300031744|Ga0306918_10329912 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300031744|Ga0306918_10545519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 908 | Open in IMG/M |
| 3300031744|Ga0306918_10550381 | Not Available | 904 | Open in IMG/M |
| 3300031754|Ga0307475_11135461 | Not Available | 610 | Open in IMG/M |
| 3300031763|Ga0318537_10079356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1208 | Open in IMG/M |
| 3300031795|Ga0318557_10424791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300031823|Ga0307478_10405269 | Not Available | 1130 | Open in IMG/M |
| 3300031823|Ga0307478_11594938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300031835|Ga0318517_10562891 | Not Available | 512 | Open in IMG/M |
| 3300031846|Ga0318512_10435835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300031860|Ga0318495_10438030 | Not Available | 574 | Open in IMG/M |
| 3300031879|Ga0306919_10601251 | Not Available | 848 | Open in IMG/M |
| 3300031890|Ga0306925_10456897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1364 | Open in IMG/M |
| 3300031890|Ga0306925_10602071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1160 | Open in IMG/M |
| 3300031910|Ga0306923_10585929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300031910|Ga0306923_10702076 | Not Available | 1126 | Open in IMG/M |
| 3300031910|Ga0306923_11897073 | Not Available | 608 | Open in IMG/M |
| 3300031912|Ga0306921_10475021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300031941|Ga0310912_11188009 | Not Available | 581 | Open in IMG/M |
| 3300031942|Ga0310916_10427626 | Not Available | 1127 | Open in IMG/M |
| 3300031947|Ga0310909_10099772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2332 | Open in IMG/M |
| 3300031947|Ga0310909_10213514 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300031962|Ga0307479_11309133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 685 | Open in IMG/M |
| 3300031965|Ga0326597_11547783 | Not Available | 634 | Open in IMG/M |
| 3300031981|Ga0318531_10272746 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300032001|Ga0306922_11757418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300032001|Ga0306922_11837112 | Not Available | 595 | Open in IMG/M |
| 3300032039|Ga0318559_10340496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 698 | Open in IMG/M |
| 3300032055|Ga0318575_10329335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 773 | Open in IMG/M |
| 3300032160|Ga0311301_12346755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300032180|Ga0307471_101892187 | Not Available | 746 | Open in IMG/M |
| 3300033289|Ga0310914_10271970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.91% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066679_103729842 | 3300005176 | Soil | MKAYHIDRFGSVGGIARRSSQDPRPGLKEVLMRVRASSLNY |
| Ga0066388_1050249581 | 3300005332 | Tropical Forest Soil | MKAYRIDRFGGVDGIVLQSSDDPRPGLGEVLIRVRTSTAPELL* |
| Ga0066388_1081513462 | 3300005332 | Tropical Forest Soil | MEEEEMEAYRIKRFGGVDGISPEVSGDPHPGPREVLMRVRAS |
| Ga0070710_114361642 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAYHIDRFGMVRRSSEDPRPGLKEVVMRVRASSLNYRDLMVL |
| Ga0070763_109252842 | 3300005610 | Soil | MEAYRIDRFGSVDGIVSRSSVDPRPGLKEVLMRVRASSLN |
| Ga0066905_1014388411 | 3300005713 | Tropical Forest Soil | MKAYRIDRFGGVDGIVLQSIDDPRPGLEEVLIRVRTSTAPELL* |
| Ga0066903_1034177521 | 3300005764 | Tropical Forest Soil | MKAYRIDRFGGVDGIVLQSIDDPRPGLGEVLIRVRTSTAPELL* |
| Ga0066903_1041920393 | 3300005764 | Tropical Forest Soil | MKAYHIDRFGGVGGIALRASEDPRPGLREILMRVRASSL |
| Ga0075028_1008087652 | 3300006050 | Watersheds | MKAYHIDRFGSVGGIVRRSSEDPRPGPKEILMRVCAS |
| Ga0070712_1012948081 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRVRASS |
| Ga0079219_101010982 | 3300006954 | Agricultural Soil | MKAYHIDRFGGVGGIVRRSSEDPRPGPKEVLMRVRASSL |
| Ga0099791_105416122 | 3300007255 | Vadose Zone Soil | MEAYRVDRFGSVDGIVLRSSEDPRLGPQEILMRVRASSL |
| Ga0099795_105314532 | 3300007788 | Vadose Zone Soil | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRVR |
| Ga0099828_115252312 | 3300009089 | Vadose Zone Soil | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRVRELA* |
| Ga0126374_106941902 | 3300009792 | Tropical Forest Soil | MKAYRIDRFVGVDGIVLQSSDDPRPGLGEVLIRMRASTAPELL* |
| Ga0126384_111790923 | 3300010046 | Tropical Forest Soil | MKAHRIDRFGGVDGIVLQSIDDPRPGLGEVLIPVRTSTAPELL* |
| Ga0126373_100335001 | 3300010048 | Tropical Forest Soil | MEAYRIDRFGSVDGIVLRSSEDPQPGPKEVLMRVR |
| Ga0134065_103104652 | 3300010326 | Grasslands Soil | MKAYHIDRFGSVGGIVRRSSEDPPPGRKEVLMRVRA |
| Ga0074045_101058212 | 3300010341 | Bog Forest Soil | MKAYRIGRFGGVDGIVLRSSEDPRPRPKEILMRVR* |
| Ga0126370_112206291 | 3300010358 | Tropical Forest Soil | MKAYHIDRFGGVGGIALRASEDPRPGLREILMRVRASSLN |
| Ga0126378_101612224 | 3300010361 | Tropical Forest Soil | VEAYRIDRFGSVDGIVLRSSEDPRPGLRQILMRVRELA* |
| Ga0126379_120943251 | 3300010366 | Tropical Forest Soil | MEAYRIDRFGSVDGLVLRSSADPRPGRKEVLMRVCASFAELT |
| Ga0126381_1027979482 | 3300010376 | Tropical Forest Soil | MEAYHIDHFGSVDGIVLRSSDNPRPERKEILMRVR* |
| Ga0150983_103647281 | 3300011120 | Forest Soil | EMEAYRIDRFGSVDGIVLRSSEDPRPGSKEILMRVPTRSTTAI* |
| Ga0137392_116225802 | 3300011269 | Vadose Zone Soil | MMEAYRIDRFGSVDGIALRSSEDPRPGPKEILMRVRA |
| Ga0137393_107491001 | 3300011271 | Vadose Zone Soil | VDNREEEEMESYRIDRFRSVDGIVLRSSDDPRPAPKEILM |
| Ga0137440_10971441 | 3300011410 | Soil | MRAYRIESFGSVDGVVLGAGDDPQPGTREILVRMRATS |
| Ga0137389_112256611 | 3300012096 | Vadose Zone Soil | MKAYRIDRFGSVEGIVLRSSEDPRPGPKEILMRVRA |
| Ga0137399_110893901 | 3300012203 | Vadose Zone Soil | MEAYRIDRFGSVDGIVLQSSEDPRPGPKEILMRVRA |
| Ga0137399_111016662 | 3300012203 | Vadose Zone Soil | MEAYRIDRFGSVDGIVLRSSEDPRLGPQEILMRVRASSL |
| Ga0137362_103774901 | 3300012205 | Vadose Zone Soil | MEAYRIDRFGSVDGIVFRSSEDPGPGPKEVLMRVCAS |
| Ga0137376_107465832 | 3300012208 | Vadose Zone Soil | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEILTRVRA |
| Ga0137360_116058691 | 3300012361 | Vadose Zone Soil | MEAYRIDSVDGVVLRSSEDPGPGPKEILMRVRASS |
| Ga0137359_111718172 | 3300012923 | Vadose Zone Soil | VDNREEEEMEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRV |
| Ga0137416_115748301 | 3300012927 | Vadose Zone Soil | MEAYRIDRFGSVDGIVLRSSDDPRSGPKEALMRVRASSL |
| Ga0137404_115651421 | 3300012929 | Vadose Zone Soil | MEAYRIDRFGSVDGIVLRSSGDPRPGPKEILMRVRASS |
| Ga0126369_117763391 | 3300012971 | Tropical Forest Soil | MEAYHIARFGSVDGIVLRSSEDPPPGRKEVLMQVRAGR* |
| Ga0182036_102903422 | 3300016270 | Soil | MEAYRIDRFGSVDGIVLRSSEDPRPGLREILMRVRASSL |
| Ga0182036_103414942 | 3300016270 | Soil | MKSYRIERFGSVDGVVLRSCDDPRPGPREILMRVRARLTTAI |
| Ga0182036_104523351 | 3300016270 | Soil | MKAHHIDRIGSIGGIVRRSAEDPRPGPKEVLMRVRASSLN |
| Ga0182036_110642652 | 3300016270 | Soil | VEAYRIDSFGSVDGIVLRSSEDPRPGLREILMRVRA |
| Ga0182041_114231192 | 3300016294 | Soil | MKACHIDRFGSVGGIALRSSEDPQPGLREVLMRVRASSLN |
| Ga0182032_105830771 | 3300016357 | Soil | MEAYRIEHFGSVDGIMLRSSEDPRPGPKEILMRVRAS |
| Ga0182032_109166212 | 3300016357 | Soil | MEAYHIERFGSVDGIVLRSSEDPRLGLKEILMRVLAS |
| Ga0182040_119648231 | 3300016387 | Soil | VEAYRIDRFGSVDGILLRSSEDPRPGLREVLMRVRA |
| Ga0182037_101078332 | 3300016404 | Soil | MQAYRIERFGSVDGIELRSNGDLRPGLREVLMRVR |
| Ga0182037_101340192 | 3300016404 | Soil | MKAYRIDRFGGVDGIVLQSVDDPRPGLGEVLIRVRTSTAPELL |
| Ga0182038_116782612 | 3300016445 | Soil | RIERFGSVDGVVLRSCDDPRPGPKEILMRVARARLTTAI |
| Ga0066662_128037191 | 3300018468 | Grasslands Soil | MQAYRIARFGSVDGIVLRSSEDPRTEPKEILMQVRASSLN |
| Ga0210406_108541811 | 3300021168 | Soil | MKAYHIDRFGSVGGIVRRSSQDPRPGPKEVLMRVLAS |
| Ga0210406_112712021 | 3300021168 | Soil | MKAYHIDRFGSVGGIVRRSSEDPRPGPKEVLMRVRASSL |
| Ga0210400_115179232 | 3300021170 | Soil | MEADRIDRFGSVDGIVLRVSADPRPGPKEVLMTVPRQLARLSGSDGPEG |
| Ga0213882_102589242 | 3300021362 | Exposed Rock | MKAYHIDRFGNVDGFVSRSSDNPRPERKEVLMRVR |
| Ga0210393_106138062 | 3300021401 | Soil | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEVLMRVRELA |
| Ga0210384_116143661 | 3300021432 | Soil | MSKGDGMKAYCIDHFGSVDGVVLQSRAEPQPGRREILVRVGATSLNY |
| Ga0210390_113092981 | 3300021474 | Soil | MKAYHIDRFGSVGGIVRRSSEDPRPGPKEVLMRVRASS |
| Ga0210410_115530141 | 3300021479 | Soil | MKAYHIDRFGSVGGIVRRSSEDPRPGPKEVLMRVRAS |
| Ga0126371_103555103 | 3300021560 | Tropical Forest Soil | MKAYRIDRFGGVDGIVLQSSDDPRPGLGEVLIRMRASTAPELL |
| Ga0126371_110338171 | 3300021560 | Tropical Forest Soil | MEAYHIARFGSVDGIVLRSSEDPPPGRKEVLMQVRADR |
| Ga0126371_130205083 | 3300021560 | Tropical Forest Soil | MKAYHIDRFGGVGGIALRASEDPRPGLREILMRVRAS |
| Ga0207692_104613132 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAYHIDRFGSVGGIVRRSSEDPQPGLKEVLMRVR |
| Ga0209473_13256381 | 3300026330 | Soil | LKAYHIDRFGSIGGIVRRSSEDPRPGLKEVLMRVCASSLN |
| Ga0207806_10428421 | 3300027049 | Tropical Forest Soil | LPRQWWRVMEAYCIDRFGSVDGIVLRSSEDPRPGLKEILMR |
| Ga0209331_10438312 | 3300027603 | Forest Soil | MEAYRIDRFGSVDGIVLRSSEDPRPEPKEILMRVRA |
| Ga0209656_101565421 | 3300027812 | Bog Forest Soil | MKAYRIGRFGGVDGIVLRSSEDPRPRPKEILMRVR |
| Ga0209693_103922211 | 3300027855 | Soil | MEAYHIERFGSVDGIVLRSSKDPRPGPKEVLMRVRAS |
| Ga0170824_1249740203 | 3300031231 | Forest Soil | MDAYRIDRFGSVDRIVLRSSDDPRPRLREVLMRVRVSLLDYR |
| Ga0170819_115791501 | 3300031469 | Forest Soil | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEILMRVRASALAT |
| Ga0318541_101267202 | 3300031545 | Soil | MKSYRIERFGSVDGVVLRSCDDPRPGPKEILMRVARARLTTAI |
| Ga0318573_104085232 | 3300031564 | Soil | MKAYRIDRFGGVDGIVLQSIDDPRPGLGEVLIRVRTSTAPELL |
| Ga0318515_101747862 | 3300031572 | Soil | MKAYRIDRFGGVDGIVLQSVDDPRPGLEEVLIRVRTSTAPELL |
| Ga0318561_100910043 | 3300031679 | Soil | MKAYRIDRFGGVDGIVLQSIDDPRPGLEEVLIRVRTSTAPELL |
| Ga0318560_105623351 | 3300031682 | Soil | MEAYRIDRFGSVDGIVLRSSPDPRPGPKEVLMRVRSS |
| Ga0310686_1070959902 | 3300031708 | Soil | MEGYHIDRFGSVDGIVLRSSEDPRPGLREVLTQVRASLLNDRDLRTGL |
| Ga0306917_104495961 | 3300031719 | Soil | RIERFGSVDGIELRSSDDPRPGLREVLMRVRASSLN |
| Ga0306917_114640531 | 3300031719 | Soil | MEAYHIDRFGSVDGIVLRSTEDPRPGLREVLMRVRASSL |
| Ga0318500_101606011 | 3300031724 | Soil | VEAYRIDSFGSVDGILLRSSEDPRPGLREVLIRVRATPL |
| Ga0306918_103299121 | 3300031744 | Soil | MKAYHVDRFGSIGGIVRRSAEDPRPGPKEVLMRVRASSL |
| Ga0306918_105455191 | 3300031744 | Soil | MKAHHIDRIGSIGGIVRRSAEDPRPGPKEVLMRVRA |
| Ga0306918_105503811 | 3300031744 | Soil | MKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRASSL |
| Ga0307475_111354612 | 3300031754 | Hardwood Forest Soil | VEAYRIDSFGSVDGILLRSSEDPRPGLREVLMRVR |
| Ga0318537_100793561 | 3300031763 | Soil | MEAYRIDHFAGVDGIVLRSSPDPRPGPKEVLMRVRA |
| Ga0318557_104247912 | 3300031795 | Soil | MQAYRIERFGSVDGIELRSSDDPRPGLREVLMRVRASTLNYRD |
| Ga0307478_104052692 | 3300031823 | Hardwood Forest Soil | MEAYHIERFGSVGGIVRRSSEDPRPGLKEVLMRVHA |
| Ga0307478_115949382 | 3300031823 | Hardwood Forest Soil | MKAYHIDRFGSVGGIVRRSSEDPRPGLKEVLTRVHAS |
| Ga0318517_105628911 | 3300031835 | Soil | MKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRAS |
| Ga0318512_104358351 | 3300031846 | Soil | MKAYRVERFGSVNGIVLRSCDDPRPGPREILMRVRARLT |
| Ga0318495_104380301 | 3300031860 | Soil | MKAYRIDRFGSIGGIVRRSAEDPRPGPKEALMRVR |
| Ga0306919_106012512 | 3300031879 | Soil | MKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRASSLN |
| Ga0306925_104568973 | 3300031890 | Soil | MKSYRIERFGSVDGVVLRSCDDPRPGPKEILMRVARARLT |
| Ga0306925_106020713 | 3300031890 | Soil | MKAYHIDRFGSIGGIARRSVEDPRPGPKEVLMRVRA |
| Ga0306923_105859291 | 3300031910 | Soil | MKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRA |
| Ga0306923_107020761 | 3300031910 | Soil | MKAYHIDRFGSIGGIARRSVEDPRPGPKEVLMRVRAS |
| Ga0306923_111705823 | 3300031910 | Soil | MKAYRIERFGSVDGVVLRSCDDPRPGPKEILMRVARARLTTAI |
| Ga0306923_118970731 | 3300031910 | Soil | GGRGGEMQAYRIERFGSVDGIELRSNGDLRPGLREVLMRVR |
| Ga0306921_104750211 | 3300031912 | Soil | MEAYHIERFGSVDGIVLRSSEDPRPGLKEILMRVRASSL |
| Ga0310912_111880092 | 3300031941 | Soil | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEVLMRVRA |
| Ga0310916_104276261 | 3300031942 | Soil | LGGASEEGEMKAYHIDRFGSVGGIVRRSAEDPRPGPKEVLMRVRAS |
| Ga0310909_100997724 | 3300031947 | Soil | MRAFRIERFGSVDGIELRSSDDPRPGLREVLMRVRA |
| Ga0310909_102135141 | 3300031947 | Soil | MKAYRIDRFGGVDGIVLQSVDDPRPGLEEVLIRVRTS |
| Ga0307479_113091331 | 3300031962 | Hardwood Forest Soil | VEAYRIDRFGSVDGVVLRSSEDPRPGLREVLMRVRATSLN |
| Ga0326597_115477832 | 3300031965 | Soil | MKSYRIESFGSVDGVVLGSRDDPRPGAREILVRVR |
| Ga0318531_102727461 | 3300031981 | Soil | AYRIDRFGGVDGIVLQSIDDPRPGLEEVLIRVRTSTAPELL |
| Ga0306922_117574182 | 3300032001 | Soil | MKAYRIERFGSVDGVVLRSCDDPRPGPKEILMRVRASS |
| Ga0306922_118371121 | 3300032001 | Soil | GGEMQAYRIERFGSVDGIELRSNGDLRPGLREVLMRVR |
| Ga0318559_103404961 | 3300032039 | Soil | MKAHHIDRIGSIGGIVRRSAEDPRPGPKEVLMRVRASS |
| Ga0318575_103293351 | 3300032055 | Soil | MKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVR |
| Ga0311301_123467551 | 3300032160 | Peatlands Soil | MGAYRIDRSGSVDGIVLRSSEDPRPRSKKILMRAGA |
| Ga0307471_1018921872 | 3300032180 | Hardwood Forest Soil | MEAYRIDRFGSVDGIVLRSSEDPRPGPKEVLMRVRAS |
| Ga0310914_102719701 | 3300033289 | Soil | MKAYHIDRFGSIGGIVRRSAEDPRPGPKEVLMRVRASS |
| ⦗Top⦘ |