


| Basic Information | |
|---|---|
| Family ID | F087517 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 47 residues |
| Representative Sequence | EALRDLLYPASPPVFPLSSSMATLVLFSAFMFGLAFIMVNRRTTKPAA |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.27 % |
| % of genes from short scaffolds (< 2000 bps) | 93.64 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.546 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.79% β-sheet: 0.00% Coil/Unstructured: 59.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF04238 | DUF420 | 78.18 |
| PF02265 | S1-P1_nuclease | 4.55 |
| PF00155 | Aminotran_1_2 | 1.82 |
| PF02585 | PIG-L | 0.91 |
| PF00436 | SSB | 0.91 |
| PF00664 | ABC_membrane | 0.91 |
| PF13304 | AAA_21 | 0.91 |
| PF00990 | GGDEF | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 78.18 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.91 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.91 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.18 % |
| Unclassified | root | N/A | 1.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10176610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 866 | Open in IMG/M |
| 3300001915|JGI24741J21665_1051480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 606 | Open in IMG/M |
| 3300004114|Ga0062593_103376597 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005175|Ga0066673_10846884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300005176|Ga0066679_10366133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300005177|Ga0066690_10402800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 929 | Open in IMG/M |
| 3300005187|Ga0066675_10199498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1405 | Open in IMG/M |
| 3300005293|Ga0065715_10225510 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300005295|Ga0065707_10179035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1430 | Open in IMG/M |
| 3300005365|Ga0070688_101406962 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005437|Ga0070710_11407551 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005445|Ga0070708_100495932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300005447|Ga0066689_11041902 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005544|Ga0070686_101900164 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005552|Ga0066701_10142637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1437 | Open in IMG/M |
| 3300005552|Ga0066701_10370881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300005556|Ga0066707_10895808 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005576|Ga0066708_10258817 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300005617|Ga0068859_100016880 | All Organisms → cellular organisms → Bacteria | 7327 | Open in IMG/M |
| 3300005719|Ga0068861_100589762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1018 | Open in IMG/M |
| 3300005843|Ga0068860_101311283 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005844|Ga0068862_102278404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 553 | Open in IMG/M |
| 3300005921|Ga0070766_10194231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1266 | Open in IMG/M |
| 3300005995|Ga0066790_10124105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300006028|Ga0070717_11954942 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006046|Ga0066652_101465270 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006047|Ga0075024_100407361 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006176|Ga0070765_100042452 | All Organisms → cellular organisms → Bacteria | 3652 | Open in IMG/M |
| 3300006237|Ga0097621_102024929 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006893|Ga0073928_10670853 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300007819|Ga0104322_128886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1503 | Open in IMG/M |
| 3300009089|Ga0099828_10631797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300009089|Ga0099828_11655158 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300009090|Ga0099827_11229653 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009174|Ga0105241_10022680 | All Organisms → cellular organisms → Bacteria | 4651 | Open in IMG/M |
| 3300009700|Ga0116217_10510009 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009792|Ga0126374_11406644 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010359|Ga0126376_12616749 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010360|Ga0126372_11576498 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300010366|Ga0126379_12839065 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012010|Ga0120118_1088406 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300012198|Ga0137364_10580860 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300012202|Ga0137363_10860499 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300012205|Ga0137362_10351753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
| 3300012207|Ga0137381_10793477 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012356|Ga0137371_11332339 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012469|Ga0150984_106980447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1875 | Open in IMG/M |
| 3300012469|Ga0150984_121335517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300012532|Ga0137373_10425564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1027 | Open in IMG/M |
| 3300012922|Ga0137394_11250450 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012929|Ga0137404_10230242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1583 | Open in IMG/M |
| 3300012929|Ga0137404_11601591 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012951|Ga0164300_10924864 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012960|Ga0164301_11634731 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012961|Ga0164302_10750140 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012961|Ga0164302_10963142 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012988|Ga0164306_10842334 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012989|Ga0164305_12012480 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300013297|Ga0157378_11361619 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300014968|Ga0157379_10099315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2613 | Open in IMG/M |
| 3300015264|Ga0137403_10298184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
| 3300015374|Ga0132255_105385536 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300017966|Ga0187776_10471267 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300017966|Ga0187776_10837311 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300018468|Ga0066662_10635743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1006 | Open in IMG/M |
| 3300018468|Ga0066662_12764818 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300019879|Ga0193723_1173853 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300020579|Ga0210407_10487679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300021377|Ga0213874_10465463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300021403|Ga0210397_10537350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300021420|Ga0210394_11626911 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021432|Ga0210384_11419348 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300021478|Ga0210402_10690057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300021559|Ga0210409_10942925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300022557|Ga0212123_10579512 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300025912|Ga0207707_10731299 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300025913|Ga0207695_11080619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300025913|Ga0207695_11516454 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300025924|Ga0207694_10808101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300025927|Ga0207687_10329372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300025927|Ga0207687_10567599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300025928|Ga0207700_10608558 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300026277|Ga0209350_1054658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300026285|Ga0209438_1227967 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026308|Ga0209265_1004198 | All Organisms → cellular organisms → Bacteria | 4431 | Open in IMG/M |
| 3300026354|Ga0257180_1062452 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300026540|Ga0209376_1248530 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300026547|Ga0209156_10101693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1428 | Open in IMG/M |
| 3300027773|Ga0209810_1173207 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300027862|Ga0209701_10470644 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300027875|Ga0209283_10487792 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300027894|Ga0209068_10898625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → unclassified Ktedonobacterales → Ktedonobacterales bacterium | 524 | Open in IMG/M |
| 3300027915|Ga0209069_10997736 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300029989|Ga0311365_10630644 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031236|Ga0302324_100798481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1314 | Open in IMG/M |
| 3300031525|Ga0302326_12338276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300031640|Ga0318555_10764674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 522 | Open in IMG/M |
| 3300031718|Ga0307474_10932293 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031720|Ga0307469_10148040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1752 | Open in IMG/M |
| 3300031720|Ga0307469_10510921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300031740|Ga0307468_101520354 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031823|Ga0307478_10876089 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300031941|Ga0310912_11315627 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300032043|Ga0318556_10434070 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300032892|Ga0335081_11176681 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300032893|Ga0335069_10667757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
| 3300033412|Ga0310810_10494204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300033475|Ga0310811_11334976 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.18% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.73% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_101766101 | 3300001867 | Forest Soil | GVEALRDLLYPGSTSAFPLASSLLILVLFAGVMFGISFLMVNRRTTKPGA* |
| JGI24741J21665_10514801 | 3300001915 | Corn Rhizosphere | YGVEALRSVLYPGSPRAFSLEASMATLVLFALVMFGVAFLMVNRKTTRPAA* |
| Ga0062593_1033765972 | 3300004114 | Soil | YGVEALRSVLYPGSRGEFSLVASMATLVLFSLVMFGAAFLIVNRRSTKPAA* |
| Ga0066673_108468841 | 3300005175 | Soil | EALRDLLYPASPAVFPFSSSLATVVLFSVFMFGLSFLIVNRRTTKPAA* |
| Ga0066679_103661333 | 3300005176 | Soil | EALRDLLYPAGPEFFPLSSSLATLVLFSALMFGLSFIMVNRRTTKPAA* |
| Ga0066690_104028003 | 3300005177 | Soil | YGVEALRQLLYPSSDGSLGASLATLILFSLLMFGLGFVMVNRRSTKPAA* |
| Ga0066675_101994983 | 3300005187 | Soil | TYGVEALRDLLYPAGQGEFSLLASMSTLILFSLFMFGLAFLMVNRRTTKPAA* |
| Ga0065715_102255104 | 3300005293 | Miscanthus Rhizosphere | YGVEALRDLLFPHSAPSFPLASSLATLILFAGAMFGLSFLMVNRRTTKPAA* |
| Ga0065707_101790354 | 3300005295 | Switchgrass Rhizosphere | EALRTLLYPGSPSDFSLTESLATLVLFSFFMFAIAFVVANRRTTKPVA* |
| Ga0070688_1014069622 | 3300005365 | Switchgrass Rhizosphere | LRTLLYPGTEAFALGASMATLILFSAFMFGLAFIMVNRRTTKPAA* |
| Ga0070710_114075511 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GVEALRQLLYPTNQNSLAASLATLVLFSLFMFGLSFVLVNRRTTKPAA* |
| Ga0070708_1004959321 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PARLESFPLSSSLATLVLFSALMFGLSFIMVNRRTTKPAA* |
| Ga0066689_110419021 | 3300005447 | Soil | ALRSLLYPATPESFSLFSSLATLILFSGFMFGLAFVMVNRRTTRPAA* |
| Ga0070686_1019001642 | 3300005544 | Switchgrass Rhizosphere | LYPGTEAFALGASMATLILFSAFMFGLAFIMVNRRTTKPAA* |
| Ga0066701_101426371 | 3300005552 | Soil | EALRQLLYPATGGTLFESMATLVLFSLFMFGLAFLMANRRTTKPAA* |
| Ga0066701_103708812 | 3300005552 | Soil | LFPGTGGALVASMATLILFSLFMFGLAFLAVNRRTTKPAA* |
| Ga0066707_108958081 | 3300005556 | Soil | LYPGSGGVLVESMATLILFSLFMFGLAFLMVNRRTTKPAA* |
| Ga0066708_102588171 | 3300005576 | Soil | TYGVDALRELLFPGTGGALLASMATLVLFSSFMFGLAFLAVNRRTTKPAA* |
| Ga0066691_109676942 | 3300005586 | Soil | LYPTNQNSLPASLATLVLFSLFMFGLSFVLVNRRTTKPAA* |
| Ga0068859_1000168809 | 3300005617 | Switchgrass Rhizosphere | VEALRQLLFPGNPGVASLSASFATLVLFSLFMFGLAFLMANRRTTKPAA* |
| Ga0068861_1005897621 | 3300005719 | Switchgrass Rhizosphere | YGVEALRTLLYPGTEAFALGASMATLILFSAFMFGLAFIMVNRRTTKPAA* |
| Ga0068860_1013112831 | 3300005843 | Switchgrass Rhizosphere | RSVLYPASRGEFSLVASMATLVLFSLVMFGAAFVMVNRRSTKPAA* |
| Ga0068862_1022784041 | 3300005844 | Switchgrass Rhizosphere | TLLYPGTEAFALGASMATLILFSAFMFGLAFIMVNRRTTKPAA* |
| Ga0070766_101942311 | 3300005921 | Soil | TYGVEALRTLLYPNGTHEFSLASSMATLILFSLFMFGLAFVVANRRTTKPVA* |
| Ga0066790_101241051 | 3300005995 | Soil | LTYGVEALRDVLFPGNLPEFPLASSLATLVLFSAFMFGLSFIMVSRRTTKPAA* |
| Ga0070717_119549421 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RTLLYPGTPEVFPLFSSLATLILFSGFMFGLAFVMVNRRTTRPAA* |
| Ga0066652_1014652702 | 3300006046 | Soil | TYGVEALRQLLYPAQAGTLFESMATLVLFSLFMFGLAFLMANRRTTKPAA* |
| Ga0075024_1004073611 | 3300006047 | Watersheds | LYPGNAAAFPLASSLATLVLFSGLMFGLSFIMVNRRSTKPAA* |
| Ga0070765_1000424527 | 3300006176 | Soil | TLLYPNGTHEFSLASSMATLILFSLFMFGLAFVVANRRTTKPVA* |
| Ga0097621_1020249292 | 3300006237 | Miscanthus Rhizosphere | GNVAEFALASSLATLVLFSAFMFGLSFVMVSRRTTKPAA* |
| Ga0073928_106708533 | 3300006893 | Iron-Sulfur Acid Spring | VEALRDLLYPGSQGEFSLLASMSTLVLFSLFMFGLAFLMVNRRTTKPAA* |
| Ga0104322_1288863 | 3300007819 | Permafrost Soil | LLYPTNQNSLAASLATLVLFSLFMFGLGFVMVNRRTTKPAA* |
| Ga0099828_106317971 | 3300009089 | Vadose Zone Soil | SLLYPASPAVFPLPASMATLVLFSLFMFSLAFVMVNRRTTKPAA* |
| Ga0099828_116551582 | 3300009089 | Vadose Zone Soil | QALRDLLYPASQGEFSLLASMATLVLFSLFMFGLAFLMVNRRSTRPAA* |
| Ga0099827_112296533 | 3300009090 | Vadose Zone Soil | NLLYPASPAVFPLSSSMATLVLFSAFMFGLAFIMVNRRTTKPAA* |
| Ga0105241_100226809 | 3300009174 | Corn Rhizosphere | TYGVESLRDLLYPGNQTEFPLTSSLATLVLFSALMFGLSFIMVSRRTTKPAA* |
| Ga0116217_105100091 | 3300009700 | Peatlands Soil | EALRDLLYPASTAVFSLPESMATLLLFTLFMFGLCFVMVNRRSTKPGA* |
| Ga0126374_114066441 | 3300009792 | Tropical Forest Soil | RQLFYPATAGESSLAAALATLVLFSFFMFGLAFLMANRRTTKPAA* |
| Ga0126376_126167491 | 3300010359 | Tropical Forest Soil | LLMQLNPLTYVVAALRELPYPAPGGALFESMPTLVLFSLFMFGLAFLMANRRTTKPAA* |
| Ga0126372_115764981 | 3300010360 | Tropical Forest Soil | TYGVEALRALLYPDVLTDTSLAASMATLVLFSLFMFGLAFVVANRRSTKPAA* |
| Ga0126379_128390651 | 3300010366 | Tropical Forest Soil | RQLFYPCTSGESSLAAAMATLVLFSLFMSGLAFLMANRRTTKPAA* |
| Ga0120118_10884061 | 3300012010 | Permafrost | TYGVEALRDLLYPASKGEFSLPASMATLVLFSLFMFGLAFLMVNRRTTKPAA* |
| Ga0137364_105808603 | 3300012198 | Vadose Zone Soil | VEALRQLLFPGSPGIASLSASLATLLLFSFFMFGLAFLMANRRTTKPVA* |
| Ga0137363_108604992 | 3300012202 | Vadose Zone Soil | ALRALLYPQSPTQFSLASSMATLVLFSLFMFGLAFVVANRRTTKPAA* |
| Ga0137362_103517534 | 3300012205 | Vadose Zone Soil | EALRDLLYSGGPEFFPLSSSLATLVLFSALMFGLSFVMVNRRTTKPAA* |
| Ga0137381_107934772 | 3300012207 | Vadose Zone Soil | QANPLTYGVEALRELLYPGGGGMLVESMATLILFSLFMFGLAFLMVNRRTTKPAA* |
| Ga0137371_113323392 | 3300012356 | Vadose Zone Soil | LRQLLYPATGGTLFESMATLVLFSLFMFGLAFLMVNRRTTKPAA* |
| Ga0150984_1069804474 | 3300012469 | Avena Fatua Rhizosphere | EALRMLLYPASPEVFPLSASLATLVLFTLVMFGLAFVMVNRRTTKPAA* |
| Ga0150984_1213355171 | 3300012469 | Avena Fatua Rhizosphere | EALRLLLYPGSTGLVSLFSAMATLLLFSLFMFGLAFVMVNRRTTKPAA* |
| Ga0137373_104255643 | 3300012532 | Vadose Zone Soil | INPLTYGVVALRQLLYPATGGTLFESMATLVLFSLFMFGLAFLMVNRRTTKPAA* |
| Ga0137394_112504503 | 3300012922 | Vadose Zone Soil | LTYGVEALRDLLYPGGPEFFPLSSSLATLVLFSALMFGLSFVMVNRRTTKPAA* |
| Ga0137404_102302424 | 3300012929 | Vadose Zone Soil | YGVEALRQLLFPGSPGIASLSASLATLLLFSLFMFGVAFLMANRRTTKPIA* |
| Ga0137404_116015912 | 3300012929 | Vadose Zone Soil | PLTYGVEALRTLMYPDAPRTFSLLESILTLVLFTMFMFGLAFALVNRKKSSG* |
| Ga0164300_109248642 | 3300012951 | Soil | PTEFPLPSSLATLVLFSALMFGLSFIMVSRRTTKPAA* |
| Ga0164301_116347312 | 3300012960 | Soil | ALRDLLYPGNLTEFPLPSSLATLVLFSALMFGLSFIMVSRRTTKPAA* |
| Ga0164302_107501403 | 3300012961 | Soil | LLYPGNLTEFPLASSLATLVLFSALMFGLSFIMVSRRTTKPAA* |
| Ga0164302_109631421 | 3300012961 | Soil | EALRELLYPASGGALFESLATLLLFSLFMFGVAFLMANRRTTKPAA* |
| Ga0164306_108423343 | 3300012988 | Soil | YPGNPTEFPLPSSLATLVLFSALMFGLSFIMVSRRTTKPAA* |
| Ga0164305_120124801 | 3300012989 | Soil | RDALYPGKLPEFPLASSLATLVLFSAFMFGLSFIMVSRRTTKPAA* |
| Ga0157378_113616191 | 3300013297 | Miscanthus Rhizosphere | NVAEFALASSLATLVLFSAFMFGLSFVMVSRRTTKPAA* |
| Ga0157379_100993151 | 3300014968 | Switchgrass Rhizosphere | PGNQTEFPLTSSLATLVLFSALMFGLSFIMVSRRTTKPAA* |
| Ga0137403_102981844 | 3300015264 | Vadose Zone Soil | LTYGVEALRQLLFPGSPGIASLSASLATLLLFSLFMFGVAFLMANRRTTKPIA* |
| Ga0132255_1053855362 | 3300015374 | Arabidopsis Rhizosphere | LRDALYPGNLTEFPLPSSLATLVLFSAFMFGLSFIMVSRRTTKPAA* |
| Ga0187776_104712673 | 3300017966 | Tropical Peatland | LLYPASNTAFPLFSSLATLILFAGTMFGLSFLMVNRRTTKPAA |
| Ga0187776_108373111 | 3300017966 | Tropical Peatland | VEGLRSLLYPASPQEFSLSASLATLILFSLFMFGLGFFMANRRTTKPAA |
| Ga0066662_106357433 | 3300018468 | Grasslands Soil | RQLLYPEIGGTLFESMATLLLFSLFMFALAFLVANRRTTKPAA |
| Ga0066662_127648183 | 3300018468 | Grasslands Soil | LRDLLYPANPGEFSLAASTATLVLFSLFMFGLAFLMVNRLSTKPAA |
| Ga0193723_11738531 | 3300019879 | Soil | ALRGLLYPAGPEFFSLSSSLATLVLFSALMFGLSFIMVNRRTAKPAA |
| Ga0179592_102301703 | 3300020199 | Vadose Zone Soil | EFFPLPSSLATLVLFSALMFGLSFIMVNRRTTKPAA |
| Ga0210407_104876793 | 3300020579 | Soil | TEFFPLSSSLATLVLFSALMFALSFVMVNRRTTKPAV |
| Ga0213874_104654631 | 3300021377 | Plant Roots | LTYGVEALRDLLYPVRGGEFSLAAALAVLVLFSLFMFSLAFGVANRRSTKPAA |
| Ga0210397_105373501 | 3300021403 | Soil | LLYPGTTEFFPLSSSLATLVLFSALMFALSFVMVNRRTTKPAA |
| Ga0210394_116269112 | 3300021420 | Soil | VEALRNLLYPASPVVSPLPVSLAALVLFTACMFGLSFIMVNRRTTRPAA |
| Ga0210384_114193481 | 3300021432 | Soil | TYGVEALRTVLYPESASQFTLQSSLATLLLFTLFMFGLAFFMASRRTTQPVA |
| Ga0210402_106900571 | 3300021478 | Soil | AEFPLVSSLATLVLFSVFMFGLSFIMVSRRTTKPAA |
| Ga0210409_109429252 | 3300021559 | Soil | GVEALRDVLYPGNLPEFPLASSLATLVLFSAFMFSLSFMMVNRRTTKPAA |
| Ga0212123_105795123 | 3300022557 | Iron-Sulfur Acid Spring | LRDLLYPGSQGEFSLLASMSTLVLFSLFMFGLAFLMVNRRTTKPAA |
| Ga0207707_107312991 | 3300025912 | Corn Rhizosphere | TYGVEALRSVLYPASRGEFSLVASMATLVLFSLVMFGAAFVMVNRRSTKPAA |
| Ga0207695_110806191 | 3300025913 | Corn Rhizosphere | EALRLLLYPGSTGLVSLFSAIATLLLFSLFMFGLAFVMVNRRTTKPAA |
| Ga0207695_115164541 | 3300025913 | Corn Rhizosphere | GVEALRSVLYPGSPRAFSLEASMATLVLFALVMFGVAFLMVNRKTTRPAA |
| Ga0207694_108081011 | 3300025924 | Corn Rhizosphere | LTYGVEALRDLLYPGNPTEFPLPSSLATLVLFSALMFGLSFIMVSRRTTKPAA |
| Ga0207687_103293721 | 3300025927 | Miscanthus Rhizosphere | NQTEFPLTSSLATLVLFSALMFGLSFIMVSRRTTKPAA |
| Ga0207687_105675991 | 3300025927 | Miscanthus Rhizosphere | DILYPGNVAEFALASSLATLVLFSAFMFGLSFVMVSRRTTKPAA |
| Ga0207700_106085582 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LLYPGSPTQFSLASSMATLILFSLFMFGLAFVVANRRTTKPAA |
| Ga0209350_10546581 | 3300026277 | Grasslands Soil | GVEALRSLLYPGTPEVFPLFSSLATLILFSGFMFGLAFVMVNRRTTKPAA |
| Ga0209438_12279672 | 3300026285 | Grasslands Soil | PLTYGVEALRILLYPDKPAEFSLASAMATLVLFSLFMFGLAFVVANRRSTKPAA |
| Ga0209265_10041981 | 3300026308 | Soil | GVEALRSLLYPASSTAFPLASSLATLILFAGAMFGLSFLMVNRRTTKPAA |
| Ga0257180_10624522 | 3300026354 | Soil | GNTAAFPLASSLATLVLFSGLMFGLSFIMVNRRSTKPAA |
| Ga0209376_12485303 | 3300026540 | Soil | YPTNAPVFPLGSSLATLLLFAVFMFTLSFLMVNRRTTKPAA |
| Ga0209156_101016933 | 3300026547 | Soil | RFSRHRVEALRQLLYPETGGTLFESMATLLLFALFMFGLAFLMANRRTTKPAA |
| Ga0209810_11732073 | 3300027773 | Surface Soil | GVEALRQLLYPTSEGALASSLATLLLFSLFMFGIAFAMVNRRTTKPAA |
| Ga0209701_104706443 | 3300027862 | Vadose Zone Soil | EALRDLLYPASPPVFPLSSSMATLVLFSAFMFGLAFIMVNRRTTKPAA |
| Ga0209283_104877921 | 3300027875 | Vadose Zone Soil | SLLYPASPAVFPLPASMATLVLFSLFMFSLAFVMVNRRTTKPAA |
| Ga0209068_108986252 | 3300027894 | Watersheds | VVRFSGEALTYGVEALRDLLYPARLESFPLSSSLATLFLFSALMFGLSFIMVNRRSTKPA |
| Ga0209069_109977361 | 3300027915 | Watersheds | PLTYGVEALRSLLYPETPAAFSLLASLLTLVLFAGFLFGIAFFLVNRRSTRVA |
| Ga0311365_106306443 | 3300029989 | Fen | YGVEALRMLLYPDSPQVFTLAASLATLLLFTLVMFGLAFVMVNRRTTKPAA |
| Ga0302324_1007984811 | 3300031236 | Palsa | YGVEALRDLLYPAAPQVFSLPESLATLTLFTLFMFGLCFVMVNRRTTKPGA |
| Ga0302326_123382761 | 3300031525 | Palsa | LYPAAPQVFSLPESMATLTLFTLFMFGLCFVMVNRRTTKPGA |
| Ga0318555_107646741 | 3300031640 | Soil | VEALRSLLYPNVPTETSLAASMATLVLFSLFMFGLAFVVANRRTTKPAA |
| Ga0307474_109322931 | 3300031718 | Hardwood Forest Soil | EALRLLLYPASMSQFTLESSLATLLLFTLFMFGIAFFVASRRTTKPVA |
| Ga0307469_101480403 | 3300031720 | Hardwood Forest Soil | ALRILLYPDKPAEFSLASAMATLVLFSLFMFGLAFVVANRRSTKPAA |
| Ga0307469_105109214 | 3300031720 | Hardwood Forest Soil | LRSLLYPATAEVFPLSSSLATLILFSGFMFGLAFVMVNRRTTRPAA |
| Ga0307468_1015203541 | 3300031740 | Hardwood Forest Soil | ALRDLLYPGNLTEFPLASSLATLVLFSALMFGLSFIMVSRRTTKPAA |
| Ga0307478_108760891 | 3300031823 | Hardwood Forest Soil | SLLYPTSVSEFSIFSSLATLVLFSLFMFGLAFVMVNRRTNKPAA |
| Ga0310912_113156271 | 3300031941 | Soil | YGVEALRTLLYPETPAQFTLQASLATLVLFTLFMFGLAFVVVNRRTTKPAA |
| Ga0318556_104340701 | 3300032043 | Soil | EALRHLLYPEGPVVFRFAACVATLLLFSLFMFGLAFVMVNRRTTKPAA |
| Ga0335081_111766811 | 3300032892 | Soil | PGAPAVASLPASLATLVLFSGFMFALAFIMVNRRTTRPAA |
| Ga0335069_106677571 | 3300032893 | Soil | ALYPGNLAEFPLASSLATLVLFSAFMFALSFVMVSRRTTKPAA |
| Ga0310810_104942044 | 3300033412 | Soil | LTYGVEALRTLLYPGTEAFALGASMATLILFSAFMFGLAFIMVNRRTTKPAA |
| Ga0310811_113349761 | 3300033475 | Soil | GVEALRDLLYPGNPTEFPLPSSLATLVLFSALMFGLSFIMVSRRTTKPAA |
| ⦗Top⦘ |