


| Basic Information | |
|---|---|
| Family ID | F087483 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 45 residues |
| Representative Sequence | IARQGGQHVLYGSALALAAALQAWSRHAGTPLIDLARTVIR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 96.36 % |
| % of genes from short scaffolds (< 2000 bps) | 84.55 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (41.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01695 | IstB_IS21 | 9.09 |
| PF08751 | TrwC | 2.73 |
| PF13604 | AAA_30 | 2.73 |
| PF08281 | Sigma70_r4_2 | 1.82 |
| PF01209 | Ubie_methyltran | 1.82 |
| PF00665 | rve | 1.82 |
| PF13683 | rve_3 | 1.82 |
| PF13676 | TIR_2 | 1.82 |
| PF04851 | ResIII | 0.91 |
| PF01979 | Amidohydro_1 | 0.91 |
| PF00583 | Acetyltransf_1 | 0.91 |
| PF00400 | WD40 | 0.91 |
| PF03050 | DDE_Tnp_IS66 | 0.91 |
| PF01243 | Putative_PNPOx | 0.91 |
| PF03824 | NicO | 0.91 |
| PF02371 | Transposase_20 | 0.91 |
| PF12728 | HTH_17 | 0.91 |
| PF13006 | Nterm_IS4 | 0.91 |
| PF02803 | Thiolase_C | 0.91 |
| PF13613 | HTH_Tnp_4 | 0.91 |
| PF13546 | DDE_5 | 0.91 |
| PF13271 | DUF4062 | 0.91 |
| PF07676 | PD40 | 0.91 |
| PF12762 | DDE_Tnp_IS1595 | 0.91 |
| PF10282 | Lactonase | 0.91 |
| PF13649 | Methyltransf_25 | 0.91 |
| PF08044 | DUF1707 | 0.91 |
| PF13374 | TPR_10 | 0.91 |
| PF07883 | Cupin_2 | 0.91 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF07690 | MFS_1 | 0.91 |
| PF01266 | DAO | 0.91 |
| PF02467 | Whib | 0.91 |
| PF03807 | F420_oxidored | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 9.09 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.82 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.82 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.82 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.82 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.82 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.82 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.91 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.73 % |
| Unclassified | root | N/A | 37.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_118565032 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300004268|Ga0066398_10091445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 692 | Open in IMG/M |
| 3300004479|Ga0062595_101566046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300005179|Ga0066684_10262513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1137 | Open in IMG/M |
| 3300005439|Ga0070711_100303239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1271 | Open in IMG/M |
| 3300005468|Ga0070707_101514619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
| 3300005554|Ga0066661_10246936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1105 | Open in IMG/M |
| 3300005559|Ga0066700_10032236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3077 | Open in IMG/M |
| 3300005614|Ga0068856_100276583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1695 | Open in IMG/M |
| 3300006046|Ga0066652_100015730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii | 5043 | Open in IMG/M |
| 3300006176|Ga0070765_101474692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 640 | Open in IMG/M |
| 3300006176|Ga0070765_101582214 | Not Available | 616 | Open in IMG/M |
| 3300009137|Ga0066709_100857478 | Not Available | 1321 | Open in IMG/M |
| 3300009521|Ga0116222_1536786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. GAS493 | 513 | Open in IMG/M |
| 3300009522|Ga0116218_1507215 | Not Available | 538 | Open in IMG/M |
| 3300009524|Ga0116225_1541030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 517 | Open in IMG/M |
| 3300009525|Ga0116220_10530784 | Not Available | 536 | Open in IMG/M |
| 3300010041|Ga0126312_11247408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300010048|Ga0126373_10099509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2686 | Open in IMG/M |
| 3300010326|Ga0134065_10172892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300010361|Ga0126378_11585686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 743 | Open in IMG/M |
| 3300010362|Ga0126377_11882737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300010366|Ga0126379_12337966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300010379|Ga0136449_103412668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300010379|Ga0136449_103739401 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012206|Ga0137380_10031520 | Not Available | 4887 | Open in IMG/M |
| 3300012206|Ga0137380_11750598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300012207|Ga0137381_10653454 | Not Available | 915 | Open in IMG/M |
| 3300012349|Ga0137387_10086809 | Not Available | 2161 | Open in IMG/M |
| 3300012349|Ga0137387_10383666 | Not Available | 1018 | Open in IMG/M |
| 3300012351|Ga0137386_10119453 | Not Available | 1875 | Open in IMG/M |
| 3300012359|Ga0137385_10026618 | Not Available | 5183 | Open in IMG/M |
| 3300012359|Ga0137385_11287246 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012362|Ga0137361_11215218 | Not Available | 677 | Open in IMG/M |
| 3300014493|Ga0182016_10163376 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300014838|Ga0182030_10276193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1885 | Open in IMG/M |
| 3300015245|Ga0137409_11087710 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300015356|Ga0134073_10221796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300016404|Ga0182037_10210563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1514 | Open in IMG/M |
| 3300016404|Ga0182037_11166405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis | 676 | Open in IMG/M |
| 3300017924|Ga0187820_1107445 | Not Available | 808 | Open in IMG/M |
| 3300017946|Ga0187879_10852138 | Not Available | 509 | Open in IMG/M |
| 3300017999|Ga0187767_10009881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1846 | Open in IMG/M |
| 3300017999|Ga0187767_10173730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 662 | Open in IMG/M |
| 3300018001|Ga0187815_10321816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
| 3300018007|Ga0187805_10215879 | Not Available | 877 | Open in IMG/M |
| 3300018018|Ga0187886_1214104 | Not Available | 738 | Open in IMG/M |
| 3300018025|Ga0187885_10219957 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300018034|Ga0187863_10535559 | Not Available | 657 | Open in IMG/M |
| 3300018047|Ga0187859_10494701 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300018057|Ga0187858_10645169 | Not Available | 635 | Open in IMG/M |
| 3300026530|Ga0209807_1029633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis tolypomycina | 2634 | Open in IMG/M |
| 3300026538|Ga0209056_10068590 | Not Available | 3057 | Open in IMG/M |
| 3300026552|Ga0209577_10612761 | Not Available | 646 | Open in IMG/M |
| 3300026908|Ga0207787_1001534 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
| 3300027817|Ga0209112_10004328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3751 | Open in IMG/M |
| 3300028801|Ga0302226_10036244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2444 | Open in IMG/M |
| 3300028808|Ga0302228_10035162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2480 | Open in IMG/M |
| 3300030007|Ga0311338_10263772 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300030057|Ga0302176_10077994 | Not Available | 1283 | Open in IMG/M |
| 3300030737|Ga0302310_10727279 | Not Available | 514 | Open in IMG/M |
| 3300031525|Ga0302326_10951653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1213 | Open in IMG/M |
| 3300031543|Ga0318516_10587968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300031544|Ga0318534_10075676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1909 | Open in IMG/M |
| 3300031546|Ga0318538_10114484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1404 | Open in IMG/M |
| 3300031546|Ga0318538_10389476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. HBU206391 | 754 | Open in IMG/M |
| 3300031546|Ga0318538_10547590 | Not Available | 627 | Open in IMG/M |
| 3300031573|Ga0310915_10542057 | Not Available | 826 | Open in IMG/M |
| 3300031640|Ga0318555_10353514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 796 | Open in IMG/M |
| 3300031670|Ga0307374_10061042 | Not Available | 3725 | Open in IMG/M |
| 3300031671|Ga0307372_10088968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2552 | Open in IMG/M |
| 3300031680|Ga0318574_10064189 | Not Available | 1966 | Open in IMG/M |
| 3300031682|Ga0318560_10730340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300031708|Ga0310686_101186235 | Not Available | 622 | Open in IMG/M |
| 3300031708|Ga0310686_108549327 | Not Available | 519 | Open in IMG/M |
| 3300031736|Ga0318501_10801668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300031747|Ga0318502_10183084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
| 3300031747|Ga0318502_10993354 | Not Available | 512 | Open in IMG/M |
| 3300031751|Ga0318494_10172565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1224 | Open in IMG/M |
| 3300031770|Ga0318521_11015424 | Not Available | 509 | Open in IMG/M |
| 3300031778|Ga0318498_10428257 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031782|Ga0318552_10147580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1180 | Open in IMG/M |
| 3300031796|Ga0318576_10277652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
| 3300031797|Ga0318550_10022025 | Not Available | 2655 | Open in IMG/M |
| 3300031805|Ga0318497_10681006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300031819|Ga0318568_11008946 | Not Available | 514 | Open in IMG/M |
| 3300031821|Ga0318567_10292753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 917 | Open in IMG/M |
| 3300031880|Ga0318544_10311991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300031894|Ga0318522_10031886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1788 | Open in IMG/M |
| 3300031910|Ga0306923_11872897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 613 | Open in IMG/M |
| 3300031912|Ga0306921_10332394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1778 | Open in IMG/M |
| 3300031942|Ga0310916_10773359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
| 3300031954|Ga0306926_10877039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1076 | Open in IMG/M |
| 3300031954|Ga0306926_11063276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 959 | Open in IMG/M |
| 3300031996|Ga0308176_11612017 | Not Available | 692 | Open in IMG/M |
| 3300032008|Ga0318562_10532173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300032009|Ga0318563_10064735 | Not Available | 1892 | Open in IMG/M |
| 3300032035|Ga0310911_10285757 | Not Available | 948 | Open in IMG/M |
| 3300032041|Ga0318549_10257478 | Not Available | 785 | Open in IMG/M |
| 3300032041|Ga0318549_10302685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300032052|Ga0318506_10519559 | Not Available | 527 | Open in IMG/M |
| 3300032054|Ga0318570_10605538 | Not Available | 500 | Open in IMG/M |
| 3300032065|Ga0318513_10603912 | Not Available | 537 | Open in IMG/M |
| 3300032066|Ga0318514_10333937 | Not Available | 802 | Open in IMG/M |
| 3300032089|Ga0318525_10617963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300032091|Ga0318577_10522846 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300032180|Ga0307471_102585811 | Not Available | 643 | Open in IMG/M |
| 3300032205|Ga0307472_100064972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2351 | Open in IMG/M |
| 3300032805|Ga0335078_10010646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 13621 | Open in IMG/M |
| 3300032805|Ga0335078_12719963 | Not Available | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.82% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1185650324 | 3300000956 | Soil | LIARQGGKHVLYGSALTLAAAAQTWAANSDTPVRELARAAVR* |
| Ga0066398_100914452 | 3300004268 | Tropical Forest Soil | SLIARQGGQHVLYGSALALAAALQAWSRHARTALPGLARTVIR* |
| Ga0062595_1015660461 | 3300004479 | Soil | LDSLIARQGGQHVLYGSALAFAAAVQAWAAQTGTPVTDLARAAVR* |
| Ga0066684_102625133 | 3300005179 | Soil | LALAGKGQAFLSLGPLIARQGGQHVLYGSALALTAAIRTWSNETGTPVPQLARTAIR* |
| Ga0070711_1003032393 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | IARQGGKHVLYGSALTLAATIQAWAAHTDTPASELARTAVR* |
| Ga0070707_1015146191 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LNTLITRQGGKHVLYGSALTLAAAIQTWATGTDTPVHDLVRAAVH* |
| Ga0066661_102469363 | 3300005554 | Soil | SSLDTLIAKQGGKHVLHGAALTLAAAVQTWAADTNTPARDLARTALR* |
| Ga0066700_100322361 | 3300005559 | Soil | KGRAFASLDALIARQGGQHVLYGSALALAAALQAWSRHAGTPLTDLARTVIR* |
| Ga0068856_1002765831 | 3300005614 | Corn Rhizosphere | QGGKHVLYGSALTLAATIQAWAAHTDTPASELARTVVR* |
| Ga0066652_1000157301 | 3300006046 | Soil | GGQHVLYGCAIVLAAALQAWARHAGTPLSNLARTVVG* |
| Ga0070765_1014746921 | 3300006176 | Soil | MIRQGGQDVLYRSAPILARSLQAWARHADTPVIHL |
| Ga0070765_1015822141 | 3300006176 | Soil | SLGTLIARQGGEQVLYGSALTLTAATQTWATRTRTPLGAITRAAVR* |
| Ga0066709_1008574781 | 3300009137 | Grasslands Soil | LNRVIARQGGRHVLFGSALALTAAIQAWSDHGGDPVPDLARTAIR* |
| Ga0116222_15367861 | 3300009521 | Peatlands Soil | NPLIARQGGRHVLYGSALPLAAALQAWSRHAGTPLTDLARTVIR* |
| Ga0116218_15072151 | 3300009522 | Peatlands Soil | HVLYGSALALAAALQAWSRHAGTPLTDLARTTIR* |
| Ga0116225_15410301 | 3300009524 | Peatlands Soil | RAFASLDSLIARQGGRHVLYGSALALAAALQAWSRHAGTPLTDLARTTIR* |
| Ga0116220_105307842 | 3300009525 | Peatlands Soil | SLITRHGGRHVLYGSALALAAALQAWSRHAGTPLTDLARTTIR* |
| Ga0126312_112474083 | 3300010041 | Serpentine Soil | LIARQGGRHVLYGSALALAAVIQTWSRSTGTPVPDLARTTIR* |
| Ga0126373_100995094 | 3300010048 | Tropical Forest Soil | VTFGRQGGQHVLYDSALVLAATLQAWARHADTTVIDLARAVIR* |
| Ga0134065_101728921 | 3300010326 | Grasslands Soil | IARQGGQHVLYGCAIVLAAALQAWARHAGTPLSNLARTVVG* |
| Ga0126378_115856861 | 3300010361 | Tropical Forest Soil | QHVLYGSALTLTAALQAWSRHAGTPVPDLARGVIR* |
| Ga0126377_118827372 | 3300010362 | Tropical Forest Soil | CKGRAFASLDPLIARQGGQHVLYGSVLALAAALQAWSQQAGTALIDLARTVIR* |
| Ga0126379_123379662 | 3300010366 | Tropical Forest Soil | IARQGGKHVLYGSALTLAAAAQAWAANSDTPVRELARAAVR* |
| Ga0136449_1034126681 | 3300010379 | Peatlands Soil | RQGGEHVLYGSALTLTAAAQTWAASTDTPIRELIQAKVR* |
| Ga0136449_1037394012 | 3300010379 | Peatlands Soil | GRAFASLDALIARQGGQHVLYGSALVLAAALQAWARHADIPLIELARTAVR* |
| Ga0137380_100315206 | 3300012206 | Vadose Zone Soil | AFASLDSLIVRQGGQHVLYGSALVLAAALQSWARHTETPLTGLARTVVR* |
| Ga0137380_117505981 | 3300012206 | Vadose Zone Soil | AFASLDSLIVRQGGQHVLYGSALVLAAALQSWARHTETPLIDLARTVVR* |
| Ga0137381_106534541 | 3300012207 | Vadose Zone Soil | RQGGRHVLYGSALALAAALQARARHAETPVIDLARTVIR* |
| Ga0137387_100868091 | 3300012349 | Vadose Zone Soil | SLIVRQGGQHVLYGSALVLAAALQSWARHTETPLTGLARTVVR* |
| Ga0137387_103836662 | 3300012349 | Vadose Zone Soil | DSLIARQGGRHVLYGSALALAAALQARARHAETPLIDLARTVIR* |
| Ga0137386_101194531 | 3300012351 | Vadose Zone Soil | RQGGQHVLYGSALVLAAILQAWARHAGTPLNELARTVVR* |
| Ga0137385_100266181 | 3300012359 | Vadose Zone Soil | FASLDSLIVRQGGQHVLYGSALVLAAALQSWARHTETPLTGLARTVVR* |
| Ga0137385_112872461 | 3300012359 | Vadose Zone Soil | SLDSLIARQGGQHVLYCSALALAAALQAWSRHAGTPLIDLARTVIR* |
| Ga0137361_112152181 | 3300012362 | Vadose Zone Soil | IVRQGGQHVLYGSALVLAAALQSWARHTETPLIDLARTVVR* |
| Ga0182016_101633763 | 3300014493 | Bog | SLIARQGGRHVLYGSALTLAAALQAWSRHTGTPLIDLARTAIR* |
| Ga0182030_102761931 | 3300014838 | Bog | GRHVLYGSALTLAAALQAWSRHTGTPLIDLARTALR* |
| Ga0137409_110877101 | 3300015245 | Vadose Zone Soil | KCLPGRGGKHVLYGSTLTLAAATWTWAAGTDTPVRDLTCTAVR* |
| Ga0134073_102217962 | 3300015356 | Grasslands Soil | LGPLIARQGGQHVLYGSALALTAAIRTWSNETGTPVPQLARTAIR* |
| Ga0182037_102105631 | 3300016404 | Soil | HHLLYGSALALAAALQAWAAQTNTPVSDLAHAAVH |
| Ga0182037_111664051 | 3300016404 | Soil | AFASLDSLIARQGGQHVLYGCAIVLGAALQAWARHAQTPLIDLARTIVR |
| Ga0187820_11074451 | 3300017924 | Freshwater Sediment | FASLDALIARQGGQHVLYGSALILAAALQAWARHAGIPLIELARTVVR |
| Ga0187879_108521381 | 3300017946 | Peatland | IARQGGQHVLYGSALALAAALQAWSRHAGTPLIDLARTVIR |
| Ga0187767_100098812 | 3300017999 | Tropical Peatland | ARQGGQHVLYGSALALAAALRAWARHAGTPLIDLARTVIR |
| Ga0187767_101737301 | 3300017999 | Tropical Peatland | RQGGQHVLYGSTLALTAALQAWSRHAGTPLIDLARTVIR |
| Ga0187815_103218161 | 3300018001 | Freshwater Sediment | MHVLYGSALTLAATIQAWAAQTDTPVSDLARTAVR |
| Ga0187805_102158792 | 3300018007 | Freshwater Sediment | ASLDTLIARQGGMHVLYGSALTLAATIQAWAAHTDTTVSHLARTAVR |
| Ga0187886_12141042 | 3300018018 | Peatland | RAFASLNALIARQGGQHVLYGSALTLAAALQAWSQHAGTPLPELARMTIR |
| Ga0187885_102199572 | 3300018025 | Peatland | ATDILTLARKRRAFASLDSLIARQGGRHVLYGSALALAAALQAWSRHAGTPLTDLARTVI |
| Ga0187863_105355592 | 3300018034 | Peatland | GRHVLYGSALTLAAALQAWSRHAGTPLIDLARTAIR |
| Ga0187859_104947011 | 3300018047 | Peatland | LDSLIARQGGRHVLYGSALALAAALQAWSRHAGTPLTDLARTVIR |
| Ga0187858_106451691 | 3300018057 | Peatland | RAFASPDSLIARQGGRHVLYGSALTLAAALQAWSRHAGTPLIDLARTAIR |
| Ga0209807_10296331 | 3300026530 | Soil | QLAGDILALAGKGQAFLSLGPLIARQGGQHVLYGSALALTAAIRTWSNETGTPVPQLARTAIR |
| Ga0209056_100685901 | 3300026538 | Soil | LDTLIARQGGEHVLYGSALTLAAAAQTWAADSDTPVREVARAAVR |
| Ga0209577_106127611 | 3300026552 | Soil | GQHVLYGSALALAAALQAWSRHAGTPLIDLARTVIR |
| Ga0207787_10015341 | 3300026908 | Tropical Forest Soil | LIARQGGQHVLYGSALVLAAALQAWARHASTPLIELARTAVR |
| Ga0209112_100043281 | 3300027817 | Forest Soil | VVASLDSLIARQGGQHVLYGSALALAAALQAWSRHAGTPLTDLARTIIR |
| Ga0302226_100362441 | 3300028801 | Palsa | IARQGGRHVLYGSALTLAAALQAWSRHTGTPLIDLARTAIR |
| Ga0302228_100351621 | 3300028808 | Palsa | DSLIARQGGRHVLYGSALTLAAALQAWSRHTGTPLIDLARTAIR |
| Ga0311338_102637722 | 3300030007 | Palsa | SLDSLIARQGGQHVLYGSALALAAALQAWSRHAATPLTDLARTVIR |
| Ga0302176_100779942 | 3300030057 | Palsa | QGGRHVLYGSALTLAAALQAWSRHTGTPLIDLARTAIR |
| Ga0302310_107272792 | 3300030737 | Palsa | GRAFASLDSLIARQGGRHVLYGSALTLAAALQAWSRHTGTPLIDLARTALR |
| Ga0302326_109516531 | 3300031525 | Palsa | LIARQGGRHVLYGSALTLAAALQAWSRHTGTPLIDLARTALR |
| Ga0318516_105879681 | 3300031543 | Soil | RAFASLDTLIARQGGKHVLYGSALTLAAAAQTWAANTDTPVRELARAAVR |
| Ga0318534_100756761 | 3300031544 | Soil | GRAFASLDSLIARQGGQHVLYGSALALAAALQAWAAQTGTPVSDLARTAVR |
| Ga0318538_101144842 | 3300031546 | Soil | SLDSLIARQGGQHVLYGSALALAAALQAWAAQTGTPVSDLARTAVR |
| Ga0318538_103894763 | 3300031546 | Soil | QHVLYGSALVLAAALQAWARHAGTPLIELARAVVR |
| Ga0318538_105475902 | 3300031546 | Soil | AVEDVLAALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0310915_105420572 | 3300031573 | Soil | GGQHVLYGSALVLAAALQAWARHAGTPLIELARAVVR |
| Ga0318555_103535141 | 3300031640 | Soil | LIARQGGQHVLYGSALALTAALQAWSRHAGTPVPDLARGIIR |
| Ga0307374_100610423 | 3300031670 | Soil | VQQLTSWSWPGRGRCFRSLDTLIARQGGKHVLYGSALALAAVTQAWTASTGEPTAELVRGIVR |
| Ga0307372_100889685 | 3300031671 | Soil | TRQGGEHVLYGSALALAAATQAWSASTGEPASDLVRAIVR |
| Ga0318574_100641891 | 3300031680 | Soil | QGGQHVLYGSALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0318560_107303402 | 3300031682 | Soil | GMHVLYGSALTLAATTQAWAAQTNTPVSDLARTAIR |
| Ga0310686_1011862351 | 3300031708 | Soil | KGRAFASLDSLIARQGGQHVLYGSALALAAALQAWSRHAGTPLIDLARTVIR |
| Ga0310686_1085493271 | 3300031708 | Soil | GRAFASLDSLIARQGGQHVLYGSALALAAALQAWSRHAGTPLIDLARTVIR |
| Ga0318501_108016681 | 3300031736 | Soil | AFASLDSLIARQGGQHVLYGSALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0318502_101830841 | 3300031747 | Soil | GGKHVLYGSALTLAAAAQTWAANTDTPVRELARAAVR |
| Ga0318502_109933541 | 3300031747 | Soil | ASLDTLIARQGGKHVLYGSALTLAAAAQTWAANSDTPVRELARAAVR |
| Ga0318494_101725652 | 3300031751 | Soil | GRHVLYGSALALAAALQPWARHAGTPLTELARTAIR |
| Ga0318521_110154241 | 3300031770 | Soil | GRAFASLDALIARPGGRHVLYGSALGLAAALQAWARHAGSPLTELARTVVR |
| Ga0318498_104282572 | 3300031778 | Soil | GRAFASLDALIARQGGQHVLYGSALVLAAALQAWARHAGTPLIEIARTVVR |
| Ga0318552_101475802 | 3300031782 | Soil | FASLDSLIARQGGQHVLYGSALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0318576_102776521 | 3300031796 | Soil | AIDALIARQGGQHVLYGSALALAAALQAWSRHAGTPVPDLARSTIR |
| Ga0318550_100220252 | 3300031797 | Soil | EGGQHVLYGSALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0318497_106810061 | 3300031805 | Soil | LDSLIARQGGQHVLYGSALALAAALQAWSRHAGTSLIDLARNIIR |
| Ga0318568_110089461 | 3300031819 | Soil | KHVLYGSALTLAAAIQAWAAQTDTPVSDLARTTVR |
| Ga0318567_102927532 | 3300031821 | Soil | EGQGGQHVLYGSALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0318544_103119912 | 3300031880 | Soil | AFASLDSLIARQGGQHVLYGSALALAAALQAWAAQTGTPVSDLARTAVR |
| Ga0318522_100318861 | 3300031894 | Soil | KGRAFAALDSLIARQGGQHVLYGSALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0306923_118728971 | 3300031910 | Soil | ILTLARKRRAFASLDALIARQGGRHVLYGSALALAAALQPWARHAGTPLTELARTAIR |
| Ga0306921_103323941 | 3300031912 | Soil | GGQHVLYGSALALAAALQAWSRHAGTPVPDLARSTIR |
| Ga0310916_107733591 | 3300031942 | Soil | KGRAFASLDALIARQGGRHVLYGSALVLAAALQAWARHAGSPLTELARTVVR |
| Ga0306926_108770392 | 3300031954 | Soil | GKHVLYGSALTLAATIQAWAAQTDTPVSDLARTTVR |
| Ga0306926_110632761 | 3300031954 | Soil | SLIARQGGQHVLYGSALALAAALRAWAAQTGTPVSDLARAAVR |
| Ga0308176_116120171 | 3300031996 | Soil | GGQHVLYGSALALAAALQAWARHAGTPLTELARTAIR |
| Ga0318562_105321731 | 3300032008 | Soil | RAFASLDSLIARQGGQHVLYGSALALAAALQAWAAQTGTPVSDLARTAVR |
| Ga0318563_100647353 | 3300032009 | Soil | ILTLAHKGRAFASLDSLIARQGGHHVLYGSALALAAALQAWAVQTDTPVSDLARAAVR |
| Ga0310911_102857571 | 3300032035 | Soil | ARQGGQHVLYGSALALAAALQAWAAQTGTPVSDLARTAVR |
| Ga0318549_102574782 | 3300032041 | Soil | KGRAFASLDSLIARQGGQHVLYGSALALAAALQAWAAQTGTPVSDLARTAVR |
| Ga0318549_103026852 | 3300032041 | Soil | LDSLIARQGGQHVLYGSALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0318506_105195591 | 3300032052 | Soil | LTLAHKGRAFASLDSLIARQGGHHVLYGSALALAAALQAWAAQTDTPVTDLARAAVR |
| Ga0318570_106055381 | 3300032054 | Soil | LAHKGRAFASLDSLIARQGGHHVLYGSALALAAALQAWAVQTDTPVSDLARAAVR |
| Ga0318513_106039121 | 3300032065 | Soil | GKGRAFSSLDALIARQGGQHVLYGSALALTAALQAWSRHAGTPVPDLARGIIR |
| Ga0318514_103339371 | 3300032066 | Soil | GEDVGGRAFASLDSLIARQGGQHVLYGSALALAAALQAWSRHAGTSLIDLARTIIR |
| Ga0318525_106179631 | 3300032089 | Soil | SLDSLIGRQGGQHVLYGSALALAAALQAWAAQTGTPVSDLARTAVR |
| Ga0318577_105228462 | 3300032091 | Soil | ASLDALIARQGGRHVLYGSALALAAALQAWARHAGTPLTELARTAIR |
| Ga0307471_1025858111 | 3300032180 | Hardwood Forest Soil | RASASLGTLIARQGGKHVLYGSALTLAATIQAWAAHTDTPASELARTAVR |
| Ga0307472_1000649721 | 3300032205 | Hardwood Forest Soil | KGRAFASLDALIARQGGQHVLYGSALALAAALQAWSRHAGTPFIDLARTVIR |
| Ga0335078_1001064612 | 3300032805 | Soil | MARQGGQQVLYGSALALAATLQAWSRHAGTPIVDLARTVIR |
| Ga0335078_127199631 | 3300032805 | Soil | RQGGQHVLYGSALALAAALQAWSRHAGTPLPDLARMTIR |
| ⦗Top⦘ |