


| Basic Information | |
|---|---|
| Family ID | F087452 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPRWMRDKLTWIVVFAAIAAASSSYSAYKVYLMTDGKAVPTKGKR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.55 % |
| % of genes near scaffold ends (potentially truncated) | 21.82 % |
| % of genes from short scaffolds (< 2000 bps) | 84.55 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.909 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 10.00 |
| PF06627 | DUF1153 | 7.27 |
| PF02557 | VanY | 6.36 |
| PF13763 | DUF4167 | 4.55 |
| PF00072 | Response_reg | 3.64 |
| PF04828 | GFA | 1.82 |
| PF00691 | OmpA | 1.82 |
| PF12802 | MarR_2 | 0.91 |
| PF00816 | Histone_HNS | 0.91 |
| PF05598 | DUF772 | 0.91 |
| PF00156 | Pribosyltran | 0.91 |
| PF08837 | DUF1810 | 0.91 |
| PF00005 | ABC_tran | 0.91 |
| PF10503 | Esterase_PHB | 0.91 |
| PF12599 | DUF3768 | 0.91 |
| PF14534 | DUF4440 | 0.91 |
| PF01255 | Prenyltransf | 0.91 |
| PF01252 | Peptidase_A8 | 0.91 |
| PF05257 | CHAP | 0.91 |
| PF08501 | Shikimate_dh_N | 0.91 |
| PF04186 | FxsA | 0.91 |
| PF05853 | BKACE | 0.91 |
| PF02515 | CoA_transf_3 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 6.36 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 6.36 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.82 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.91 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.91 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.91 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.91 |
| COG3030 | FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family | General function prediction only [R] | 0.91 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.91 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.91 % |
| Unclassified | root | N/A | 39.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101912407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3248 | Open in IMG/M |
| 3300000550|F24TB_13363563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300000787|JGI11643J11755_11094398 | Not Available | 551 | Open in IMG/M |
| 3300000789|JGI1027J11758_12523154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300000956|JGI10216J12902_118874098 | Not Available | 641 | Open in IMG/M |
| 3300004114|Ga0062593_101324836 | Not Available | 764 | Open in IMG/M |
| 3300004463|Ga0063356_100445771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1687 | Open in IMG/M |
| 3300004463|Ga0063356_105270313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300004479|Ga0062595_100931719 | Not Available | 736 | Open in IMG/M |
| 3300004479|Ga0062595_102038121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300005093|Ga0062594_102717348 | Not Available | 548 | Open in IMG/M |
| 3300005177|Ga0066690_10671719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300005332|Ga0066388_100136209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 3011 | Open in IMG/M |
| 3300005334|Ga0068869_100691381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 869 | Open in IMG/M |
| 3300005353|Ga0070669_100591061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
| 3300005367|Ga0070667_102208066 | Not Available | 518 | Open in IMG/M |
| 3300005440|Ga0070705_101634275 | Not Available | 543 | Open in IMG/M |
| 3300005441|Ga0070700_100784774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300005457|Ga0070662_101259919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300005518|Ga0070699_101975519 | Not Available | 533 | Open in IMG/M |
| 3300005564|Ga0070664_101282008 | Not Available | 692 | Open in IMG/M |
| 3300005577|Ga0068857_102091720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300005719|Ga0068861_102152350 | Not Available | 558 | Open in IMG/M |
| 3300005764|Ga0066903_100937927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1572 | Open in IMG/M |
| 3300006038|Ga0075365_10023721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3861 | Open in IMG/M |
| 3300006038|Ga0075365_10066411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2420 | Open in IMG/M |
| 3300006042|Ga0075368_10039619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1848 | Open in IMG/M |
| 3300006046|Ga0066652_100126617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2106 | Open in IMG/M |
| 3300006046|Ga0066652_100565099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1067 | Open in IMG/M |
| 3300006046|Ga0066652_100816195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
| 3300006051|Ga0075364_10096263 | Not Available | 1968 | Open in IMG/M |
| 3300006177|Ga0075362_10751405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300006178|Ga0075367_10010957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4778 | Open in IMG/M |
| 3300006196|Ga0075422_10323847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300006353|Ga0075370_10915103 | Not Available | 536 | Open in IMG/M |
| 3300006791|Ga0066653_10094422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1350 | Open in IMG/M |
| 3300006844|Ga0075428_100027717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6267 | Open in IMG/M |
| 3300006844|Ga0075428_100544577 | Not Available | 1241 | Open in IMG/M |
| 3300006845|Ga0075421_100000477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 42013 | Open in IMG/M |
| 3300006846|Ga0075430_101029260 | Not Available | 678 | Open in IMG/M |
| 3300006852|Ga0075433_10141823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2136 | Open in IMG/M |
| 3300006852|Ga0075433_10169678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1942 | Open in IMG/M |
| 3300006852|Ga0075433_10809250 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300006852|Ga0075433_10947824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 750 | Open in IMG/M |
| 3300006854|Ga0075425_101698293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 710 | Open in IMG/M |
| 3300007076|Ga0075435_100606191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
| 3300009156|Ga0111538_10150690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2955 | Open in IMG/M |
| 3300009156|Ga0111538_14113508 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009162|Ga0075423_11097825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 847 | Open in IMG/M |
| 3300009176|Ga0105242_12975670 | Not Available | 524 | Open in IMG/M |
| 3300009837|Ga0105058_1184498 | Not Available | 517 | Open in IMG/M |
| 3300010038|Ga0126315_10061349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2071 | Open in IMG/M |
| 3300010044|Ga0126310_11524798 | Not Available | 549 | Open in IMG/M |
| 3300010046|Ga0126384_11608694 | Not Available | 612 | Open in IMG/M |
| 3300010366|Ga0126379_12569401 | Not Available | 607 | Open in IMG/M |
| 3300010366|Ga0126379_13227591 | Not Available | 546 | Open in IMG/M |
| 3300010397|Ga0134124_12359620 | Not Available | 573 | Open in IMG/M |
| 3300010399|Ga0134127_10319496 | Not Available | 1503 | Open in IMG/M |
| 3300010400|Ga0134122_11143954 | Not Available | 775 | Open in IMG/M |
| 3300011119|Ga0105246_10833442 | Not Available | 821 | Open in IMG/M |
| 3300011440|Ga0137433_1012704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2484 | Open in IMG/M |
| 3300012081|Ga0154003_1097417 | Not Available | 513 | Open in IMG/M |
| 3300012349|Ga0137387_10783590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300012930|Ga0137407_11053634 | Not Available | 771 | Open in IMG/M |
| 3300012944|Ga0137410_10377305 | Not Available | 1139 | Open in IMG/M |
| 3300012948|Ga0126375_10862375 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012957|Ga0164303_10451909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 809 | Open in IMG/M |
| 3300012961|Ga0164302_10109070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1549 | Open in IMG/M |
| 3300012987|Ga0164307_10485336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 930 | Open in IMG/M |
| 3300014325|Ga0163163_13293545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300014326|Ga0157380_11598640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300014968|Ga0157379_10726854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300015084|Ga0167654_1044745 | Not Available | 624 | Open in IMG/M |
| 3300015195|Ga0167658_1005494 | All Organisms → cellular organisms → Bacteria | 4332 | Open in IMG/M |
| 3300015195|Ga0167658_1009793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3001 | Open in IMG/M |
| 3300015371|Ga0132258_13314320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1108 | Open in IMG/M |
| 3300015373|Ga0132257_100099848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3339 | Open in IMG/M |
| 3300017792|Ga0163161_11549952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300017997|Ga0184610_1031994 | Not Available | 1481 | Open in IMG/M |
| 3300018053|Ga0184626_10097022 | Not Available | 1248 | Open in IMG/M |
| 3300018056|Ga0184623_10034416 | Not Available | 2290 | Open in IMG/M |
| 3300018422|Ga0190265_12786546 | Not Available | 584 | Open in IMG/M |
| 3300018429|Ga0190272_10397098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1123 | Open in IMG/M |
| 3300018429|Ga0190272_11069629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300018429|Ga0190272_11452946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300018429|Ga0190272_11453474 | Not Available | 693 | Open in IMG/M |
| 3300018433|Ga0066667_10311950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1230 | Open in IMG/M |
| 3300018476|Ga0190274_11044274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 894 | Open in IMG/M |
| 3300018482|Ga0066669_10145118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1736 | Open in IMG/M |
| 3300019377|Ga0190264_10743008 | Not Available | 734 | Open in IMG/M |
| 3300021560|Ga0126371_11367681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 840 | Open in IMG/M |
| 3300025899|Ga0207642_11098915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300025918|Ga0207662_10372550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300025926|Ga0207659_11864776 | Not Available | 510 | Open in IMG/M |
| 3300025936|Ga0207670_11159303 | Not Available | 653 | Open in IMG/M |
| 3300025972|Ga0207668_12045376 | Not Available | 516 | Open in IMG/M |
| 3300025972|Ga0207668_12067486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300026035|Ga0207703_11846796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300026067|Ga0207678_11936882 | Not Available | 514 | Open in IMG/M |
| 3300026075|Ga0207708_10741974 | Not Available | 842 | Open in IMG/M |
| 3300026118|Ga0207675_102222498 | Not Available | 563 | Open in IMG/M |
| 3300026377|Ga0257171_1079068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 579 | Open in IMG/M |
| 3300027866|Ga0209813_10022466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1784 | Open in IMG/M |
| 3300027866|Ga0209813_10133831 | Not Available | 874 | Open in IMG/M |
| 3300027909|Ga0209382_10004227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 19316 | Open in IMG/M |
| 3300028536|Ga0137415_10268356 | Not Available | 1513 | Open in IMG/M |
| 3300031716|Ga0310813_10869384 | Not Available | 816 | Open in IMG/M |
| 3300031720|Ga0307469_11200366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 717 | Open in IMG/M |
| 3300032180|Ga0307471_100288300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1721 | Open in IMG/M |
| 3300034965|Ga0370497_0035668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.18% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 8.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.73% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1019124074 | 3300000364 | Soil | MRWIRDKMTWVVLFAAIAATSSAYSAYKLYLMTDGRPVPATKSKR* |
| F24TB_133635631 | 3300000550 | Soil | MPRWLIDXXXXXXIFAAIAAASSSYSAYKIYLMTDGKPPVVKGKR* |
| JGI11643J11755_110943982 | 3300000787 | Soil | MRDKLTWILVFAFISAGGSTYSAYKVYQMTDGRPAPTKNKR* |
| JGI1027J11758_125231541 | 3300000789 | Soil | MPRWLXDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR* |
| JGI10216J12902_1188740982 | 3300000956 | Soil | MPRWMRDKITWVVLFAGIAAASSAYSAYKLFQMPDGKLLASKSKR* |
| Ga0062593_1013248362 | 3300004114 | Soil | MRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSKR* |
| Ga0063356_1004457713 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRDKLTWILVFAFIAAGGSTYSAYKVYQMTDGRPAPTKNKR* |
| Ga0063356_1052703131 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPRWLTDKLIWILVFAAIAAGASSYGAYKTYLMTDGKSVPAKGKR* |
| Ga0062595_1009317191 | 3300004479 | Soil | CSRVGPRGEDREMPRWLTDKMTWLVVFAAIAAASSSYSAYKIYQMTDGKPVATKGKR* |
| Ga0062595_1020381211 | 3300004479 | Soil | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVVKGKR* |
| Ga0062594_1027173482 | 3300005093 | Soil | TKREDREMPRWLTDKMTWLVVFAALAAASSSYSAYKIYQMTDGKPVPTKGKR* |
| Ga0066690_106717191 | 3300005177 | Soil | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVA |
| Ga0066388_1001362094 | 3300005332 | Tropical Forest Soil | MRWLTDKSLWLVLLAAIAAASSSYSAYKIYQMTDGKAAAAAAKSRR* |
| Ga0068869_1006913811 | 3300005334 | Miscanthus Rhizosphere | VGEKDVHMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR* |
| Ga0070669_1005910612 | 3300005353 | Switchgrass Rhizosphere | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKG |
| Ga0070667_1022080662 | 3300005367 | Switchgrass Rhizosphere | MPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR |
| Ga0070705_1016342752 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRWMRDKLTWIVVFAAIAAASSSYSAYKVYLMTDGKAVPTKGKR* |
| Ga0070700_1007847742 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRWIRDKLTWIVVFAAIAAASSVYSAYKLYQMTDGRPVPTKSKR* |
| Ga0070662_1012599192 | 3300005457 | Corn Rhizosphere | MPRWLTDRMTWLVIFAAIGAASSSYSAYKIYLMTDGKPPVVKGKR* |
| Ga0070699_1019755191 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR* |
| Ga0070664_1012820082 | 3300005564 | Corn Rhizosphere | MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPGPVPAKSKR* |
| Ga0068857_1020917202 | 3300005577 | Corn Rhizosphere | MPRGLTDRLTWILVFAAIAAASSSYAAYKIYLMTDARPVPTK |
| Ga0068861_1021523501 | 3300005719 | Switchgrass Rhizosphere | MPRWMRDKLTWVVLFVGIAAASSAYSAYKLFQMTDGRLVASKSKR* |
| Ga0066903_1009379272 | 3300005764 | Tropical Forest Soil | MPRWMRDKLTWIVVFAAVAAVSSAYSAYKLYQMTDGRPVPTKSRK* |
| Ga0075365_100237214 | 3300006038 | Populus Endosphere | MRDKLTWILVFAFIAAGGSSYSAYKTYQMTDGRPAPTKNKR* |
| Ga0075365_100664113 | 3300006038 | Populus Endosphere | MPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR* |
| Ga0075368_100396191 | 3300006042 | Populus Endosphere | MPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR* |
| Ga0066652_1001266173 | 3300006046 | Soil | MPRWLRDKMTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKAKR* |
| Ga0066652_1005650991 | 3300006046 | Soil | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR* |
| Ga0066652_1008161952 | 3300006046 | Soil | MPRWLIDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR* |
| Ga0075364_100962633 | 3300006051 | Populus Endosphere | MPRWMRDKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR* |
| Ga0075362_107514052 | 3300006177 | Populus Endosphere | DVHMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR* |
| Ga0075367_100109576 | 3300006178 | Populus Endosphere | MPRWMREKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR* |
| Ga0075422_103238472 | 3300006196 | Populus Rhizosphere | MRWITDKMTWFMVFAAIAAASSSYSAYKTYSMTDGK |
| Ga0075370_109151032 | 3300006353 | Populus Endosphere | MPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPV |
| Ga0066653_100944222 | 3300006791 | Soil | MPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDARTPVTKAKR* |
| Ga0075428_1000277175 | 3300006844 | Populus Rhizosphere | MRWITDKMTWLMVFAAIAAASSSYSAYKTYLMTDGKAVPTAVPTKGKR* |
| Ga0075428_1005445772 | 3300006844 | Populus Rhizosphere | MPRWMKDKLTWILVLAFITAGSSGYSAYKIYLMTDGKAAPAKGRR* |
| Ga0075421_10000047713 | 3300006845 | Populus Rhizosphere | MRWLRDKTLWVMLFAAIAAASSSYSAYKVYQMTDGKAAPTKAKGKR* |
| Ga0075430_1010292602 | 3300006846 | Populus Rhizosphere | MRWLRDKMTWLAVLVAIAAASSSYSAYKIYLMTDGKAVPAKGKR* |
| Ga0075433_101418235 | 3300006852 | Populus Rhizosphere | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR* |
| Ga0075433_101696782 | 3300006852 | Populus Rhizosphere | MPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDSKMPVTKAKR* |
| Ga0075433_108092502 | 3300006852 | Populus Rhizosphere | MPRWMKDRLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR* |
| Ga0075433_109478242 | 3300006852 | Populus Rhizosphere | MRWIKDKMTWVVLFAAIAATSSAYSAYKLYQMTDGRPVPATKSKR* |
| Ga0075425_1016982932 | 3300006854 | Populus Rhizosphere | MTWLVILAAIAAASSSYSAYKIYLMTDSKMPVTKAKR* |
| Ga0075435_1006061912 | 3300007076 | Populus Rhizosphere | MPRWLTDRMTWLVIFAAIGAASSSYSAYKIYLMTDGKPPV |
| Ga0111538_101506901 | 3300009156 | Populus Rhizosphere | RWMKDRLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR* |
| Ga0111538_141135081 | 3300009156 | Populus Rhizosphere | MPRWMKDKLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR* |
| Ga0075423_110978252 | 3300009162 | Populus Rhizosphere | MPRWMNNKLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR* |
| Ga0105242_129756702 | 3300009176 | Miscanthus Rhizosphere | MPRWFTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR* |
| Ga0105058_11844981 | 3300009837 | Groundwater Sand | MRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK* |
| Ga0126315_100613493 | 3300010038 | Serpentine Soil | MREKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR* |
| Ga0126310_115247982 | 3300010044 | Serpentine Soil | MRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR* |
| Ga0126384_116086942 | 3300010046 | Tropical Forest Soil | RSTSGVRRMPRWITDKLAWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR* |
| Ga0126379_125694011 | 3300010366 | Tropical Forest Soil | MRDKLTWIVVFAAVAAASSAYSAYKLYQMTDGRPVPTKSRK* |
| Ga0126379_132275912 | 3300010366 | Tropical Forest Soil | MPRWITDKLAWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR* |
| Ga0134124_123596201 | 3300010397 | Terrestrial Soil | LVGKLLLQGRTKREDREMPRWLTDKMTWLVVFAAIAAASSSYSAYKIYQMTDGKPVPTKGKR* |
| Ga0134127_103194961 | 3300010399 | Terrestrial Soil | MRDKLTWIVVFAAVAAASSSYSAYKVYLMTDGKAVPTKGKR* |
| Ga0134122_111439542 | 3300010400 | Terrestrial Soil | MPRWIRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKSKR* |
| Ga0105246_108334422 | 3300011119 | Miscanthus Rhizosphere | MRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKSKR* |
| Ga0137433_10127044 | 3300011440 | Soil | MPRWMRDKLTWIVVFAAIAAASSSYSAYKIYLMTDGKAVPTKGRR* |
| Ga0154003_10974172 | 3300012081 | Attine Ant Fungus Gardens | MRDKLTWILVFAFIAAGGSSYSAYKVYQMTDGRPAPTKNK |
| Ga0137387_107835901 | 3300012349 | Vadose Zone Soil | MPRWLTDKLTWVLIFAAIAAASSSYGAYKIYLMTDGK |
| Ga0137407_110536342 | 3300012930 | Vadose Zone Soil | MIWLLLLAAIAAASSSYSAYKVYLMTDGRPVPTKGKR* |
| Ga0137410_103773053 | 3300012944 | Vadose Zone Soil | MTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKAKR* |
| Ga0126375_108623751 | 3300012948 | Tropical Forest Soil | MPRWITDKLTWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR* |
| Ga0164303_104519091 | 3300012957 | Soil | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVTKGKR* |
| Ga0164302_101090703 | 3300012961 | Soil | MPRGLTDRLTWILVFAAIAAASSSYAAYKIYLMTDARPVPTKAKR* |
| Ga0164307_104853362 | 3300012987 | Soil | MPRWFTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVTKGKR* |
| Ga0163163_132935451 | 3300014325 | Switchgrass Rhizosphere | MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPS |
| Ga0157380_115986402 | 3300014326 | Switchgrass Rhizosphere | MSRWLTDKLTWILILAAIAAASSSYGAYKIYLMTDGKPA |
| Ga0157379_107268542 | 3300014968 | Switchgrass Rhizosphere | MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVSVKSKR* |
| Ga0167654_10447452 | 3300015084 | Glacier Forefield Soil | MPRWIRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKGKR* |
| Ga0167658_10054943 | 3300015195 | Glacier Forefield Soil | MPRWLRDKLTWILVFAAVAAVSSTYSAYKTYQMTDGRQVPAKSRR* |
| Ga0167658_10097934 | 3300015195 | Glacier Forefield Soil | MTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKARR* |
| Ga0132258_133143201 | 3300015371 | Arabidopsis Rhizosphere | MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR* |
| Ga0132257_1000998486 | 3300015373 | Arabidopsis Rhizosphere | MPRWLIDRMTWLLIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR* |
| Ga0163161_115499521 | 3300017792 | Switchgrass Rhizosphere | MPRWLTDRMTWLVIFATIAAASSSYSAYKIYLMTDGKPPVAKGKR |
| Ga0184610_10319942 | 3300017997 | Groundwater Sediment | MRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK |
| Ga0184626_100970221 | 3300018053 | Groundwater Sediment | GSDAPMRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK |
| Ga0184623_100344162 | 3300018056 | Groundwater Sediment | MRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK |
| Ga0190265_127865461 | 3300018422 | Soil | MPRWLTDKLTWILILAAISAASSSYGAYKIYLMTDGKPVPARGKR |
| Ga0190272_103970981 | 3300018429 | Soil | MRWIRDKMTWLVVFAAIAAATSSYNAYKIYLMTDGKPVPAAAKAKR |
| Ga0190272_110696293 | 3300018429 | Soil | MPRWLTDKMTWILVFAAIAAASSSYGAYKTYLMTDGK |
| Ga0190272_114529461 | 3300018429 | Soil | MPRWMKDKLTWILVLAFISAASSGYSAYKIYLMTDGKPAPAKGRR |
| Ga0190272_114534741 | 3300018429 | Soil | MTWLVVFAAIAATSSSYSAYKIYLMTDGKAAPAAKGRR |
| Ga0066667_103119502 | 3300018433 | Grasslands Soil | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR |
| Ga0190274_110442742 | 3300018476 | Soil | MRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR |
| Ga0066669_101451182 | 3300018482 | Grasslands Soil | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR |
| Ga0190264_107430081 | 3300019377 | Soil | MRWFRDKMTWLVVFAAIAATSSSYSAYKIYLMTDGKAAPPVKGKR |
| Ga0126371_113676812 | 3300021560 | Tropical Forest Soil | MPRWITDKLTWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR |
| Ga0207642_110989152 | 3300025899 | Miscanthus Rhizosphere | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTGGKPPVV |
| Ga0207662_103725502 | 3300025918 | Switchgrass Rhizosphere | MRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSKR |
| Ga0207659_118647762 | 3300025926 | Miscanthus Rhizosphere | MRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSK |
| Ga0207670_111593032 | 3300025936 | Switchgrass Rhizosphere | MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR |
| Ga0207668_120453762 | 3300025972 | Switchgrass Rhizosphere | MRDKLTWVVVFAGIAAASSAYSAYKLYQMTDGRPMATKSKR |
| Ga0207668_120674861 | 3300025972 | Switchgrass Rhizosphere | MPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDAKTPLTKAKR |
| Ga0207703_118467961 | 3300026035 | Switchgrass Rhizosphere | MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKP |
| Ga0207678_119368822 | 3300026067 | Corn Rhizosphere | MRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAP |
| Ga0207708_107419742 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEDESMPRWIRDKLTWIVVFAAIAAASSVYSAYKLYQMTDGRPVPTKSKR |
| Ga0207675_1022224982 | 3300026118 | Switchgrass Rhizosphere | MPRWMRDKLTWVVLFVGIAAASSAYSAYKLFQMTDGRLVASKSKR |
| Ga0257171_10790681 | 3300026377 | Soil | PRWLRDRMTWLVVLAAIAAASSSYSAYKIYLMTDAKTPVTKVKR |
| Ga0209813_100224664 | 3300027866 | Populus Endosphere | MPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR |
| Ga0209813_101338312 | 3300027866 | Populus Endosphere | MRWIKDKMTWVVLFAAIAATSSAYSAYKLYLMTDGRPVPASKSKR |
| Ga0209382_1000422710 | 3300027909 | Populus Rhizosphere | MRWLRDKTLWVMLFAAIAAASSSYSAYKVYQMTDGKAAPTKAKGKR |
| Ga0137415_102683562 | 3300028536 | Vadose Zone Soil | MTWLVLFAAIAAASSSYSAYKIYLMTDGKPVLTKAKR |
| Ga0310813_108693841 | 3300031716 | Soil | MRWIKDKMTWVVLFAAIAATSSAYSAYKLYQMTDGRPVPATKSKR |
| Ga0307469_112003662 | 3300031720 | Hardwood Forest Soil | MRWIRDKMTWVVVFAAIAATSSAYSAYKLYQMTDGRPAPTTKSKR |
| Ga0307471_1002883004 | 3300032180 | Hardwood Forest Soil | MRWITDKMTWLMVFAAIAAASSSYSAYKTYLMTDGKAVPTAVPTKGKR |
| Ga0370497_0035668_211_354 | 3300034965 | Untreated Peat Soil | MPRWLTDKMTWLIVLAAITAASSSYSAYKLYLMTDGKPAAASTKSKR |
| ⦗Top⦘ |