


| Basic Information | |
|---|---|
| Family ID | F087448 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTTVPISASEPQKPATPATPQQQTQGNPPKPADKPSEQQK |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 71.56 % |
| % of genes near scaffold ends (potentially truncated) | 22.73 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.182 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF08379 | Bact_transglu_N | 4.55 |
| PF04392 | ABC_sub_bind | 3.64 |
| PF06684 | AA_synth | 2.73 |
| PF03401 | TctC | 1.82 |
| PF07536 | HWE_HK | 1.82 |
| PF13467 | RHH_4 | 0.91 |
| PF13545 | HTH_Crp_2 | 0.91 |
| PF00027 | cNMP_binding | 0.91 |
| PF13340 | DUF4096 | 0.91 |
| PF13581 | HATPase_c_2 | 0.91 |
| PF00154 | RecA | 0.91 |
| PF06186 | DUF992 | 0.91 |
| PF13604 | AAA_30 | 0.91 |
| PF04545 | Sigma70_r4 | 0.91 |
| PF06689 | zf-C4_ClpX | 0.91 |
| PF03734 | YkuD | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 4.55 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.64 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.82 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 1.82 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 1.82 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.91 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.18 % |
| All Organisms | root | All Organisms | 31.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT01CP1G1 | Not Available | 653 | Open in IMG/M |
| 3300001686|C688J18823_10199110 | Not Available | 1352 | Open in IMG/M |
| 3300002568|C688J35102_117700524 | Not Available | 500 | Open in IMG/M |
| 3300003312|P12013IDBA_1036330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300003996|Ga0055467_10062067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
| 3300003998|Ga0055472_10256293 | Not Available | 553 | Open in IMG/M |
| 3300004067|Ga0055485_10024242 | Not Available | 1208 | Open in IMG/M |
| 3300004081|Ga0063454_100837603 | Not Available | 717 | Open in IMG/M |
| 3300004082|Ga0062384_100525669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 788 | Open in IMG/M |
| 3300004153|Ga0063455_100304018 | Not Available | 877 | Open in IMG/M |
| 3300004157|Ga0062590_100104152 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300004157|Ga0062590_100196719 | Not Available | 1451 | Open in IMG/M |
| 3300004479|Ga0062595_100614265 | Not Available | 850 | Open in IMG/M |
| 3300005327|Ga0070658_11700176 | Not Available | 546 | Open in IMG/M |
| 3300005330|Ga0070690_100819710 | Not Available | 723 | Open in IMG/M |
| 3300005341|Ga0070691_10410758 | Not Available | 765 | Open in IMG/M |
| 3300005434|Ga0070709_10491033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 931 | Open in IMG/M |
| 3300005434|Ga0070709_11049989 | Not Available | 650 | Open in IMG/M |
| 3300005447|Ga0066689_10940275 | Not Available | 533 | Open in IMG/M |
| 3300005471|Ga0070698_100863554 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300005543|Ga0070672_100774632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 843 | Open in IMG/M |
| 3300005544|Ga0070686_100702339 | Not Available | 807 | Open in IMG/M |
| 3300005548|Ga0070665_100168390 | Not Available | 2193 | Open in IMG/M |
| 3300005563|Ga0068855_100590154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1199 | Open in IMG/M |
| 3300005578|Ga0068854_101974327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 537 | Open in IMG/M |
| 3300005616|Ga0068852_101459103 | Not Available | 706 | Open in IMG/M |
| 3300005842|Ga0068858_101143022 | Not Available | 765 | Open in IMG/M |
| 3300005842|Ga0068858_101240459 | Not Available | 733 | Open in IMG/M |
| 3300006028|Ga0070717_10308401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
| 3300006046|Ga0066652_100393727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1260 | Open in IMG/M |
| 3300006047|Ga0075024_100153014 | Not Available | 1052 | Open in IMG/M |
| 3300006047|Ga0075024_100618588 | Not Available | 584 | Open in IMG/M |
| 3300006048|Ga0075363_100443465 | Not Available | 766 | Open in IMG/M |
| 3300006178|Ga0075367_10165980 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300006178|Ga0075367_10389308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300006178|Ga0075367_10923122 | Not Available | 557 | Open in IMG/M |
| 3300006353|Ga0075370_10609149 | Not Available | 662 | Open in IMG/M |
| 3300006791|Ga0066653_10304658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300006844|Ga0075428_101004721 | Not Available | 883 | Open in IMG/M |
| 3300006854|Ga0075425_101846964 | Not Available | 678 | Open in IMG/M |
| 3300006881|Ga0068865_101334933 | Not Available | 638 | Open in IMG/M |
| 3300006904|Ga0075424_101593648 | Not Available | 692 | Open in IMG/M |
| 3300008886|Ga0115930_1035886 | Not Available | 1257 | Open in IMG/M |
| 3300009012|Ga0066710_102534389 | Not Available | 740 | Open in IMG/M |
| 3300009012|Ga0066710_103382740 | Not Available | 607 | Open in IMG/M |
| 3300009053|Ga0105095_10071287 | Not Available | 1873 | Open in IMG/M |
| 3300009094|Ga0111539_10890399 | Not Available | 1035 | Open in IMG/M |
| 3300009098|Ga0105245_11350289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300009098|Ga0105245_11807547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300009098|Ga0105245_12966189 | Not Available | 526 | Open in IMG/M |
| 3300009545|Ga0105237_12015965 | Not Available | 586 | Open in IMG/M |
| 3300009553|Ga0105249_10218801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 1873 | Open in IMG/M |
| 3300010159|Ga0099796_10278328 | Not Available | 703 | Open in IMG/M |
| 3300010371|Ga0134125_10531013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1302 | Open in IMG/M |
| 3300010375|Ga0105239_11547916 | Not Available | 766 | Open in IMG/M |
| 3300010396|Ga0134126_10454038 | Not Available | 1483 | Open in IMG/M |
| 3300010400|Ga0134122_10393080 | Not Available | 1222 | Open in IMG/M |
| 3300011414|Ga0137442_1108537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 607 | Open in IMG/M |
| 3300012212|Ga0150985_102518797 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300012227|Ga0137449_1103917 | Not Available | 618 | Open in IMG/M |
| 3300012469|Ga0150984_100903548 | Not Available | 842 | Open in IMG/M |
| 3300012930|Ga0137407_10567195 | Not Available | 1064 | Open in IMG/M |
| 3300012957|Ga0164303_11113371 | Not Available | 571 | Open in IMG/M |
| 3300012961|Ga0164302_10172222 | Not Available | 1300 | Open in IMG/M |
| 3300012984|Ga0164309_11083504 | Not Available | 665 | Open in IMG/M |
| 3300014270|Ga0075325_1013108 | Not Available | 1474 | Open in IMG/M |
| 3300014310|Ga0075331_1078610 | Not Available | 756 | Open in IMG/M |
| 3300014322|Ga0075355_1115424 | Not Available | 682 | Open in IMG/M |
| 3300015087|Ga0167637_1003311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2459 | Open in IMG/M |
| 3300015245|Ga0137409_11190093 | Not Available | 603 | Open in IMG/M |
| 3300017792|Ga0163161_11185115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300017965|Ga0190266_10011973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2258 | Open in IMG/M |
| 3300017965|Ga0190266_10594062 | Not Available | 668 | Open in IMG/M |
| 3300017965|Ga0190266_10682520 | Not Available | 638 | Open in IMG/M |
| 3300018007|Ga0187805_10278872 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300018469|Ga0190270_13363619 | Not Available | 507 | Open in IMG/M |
| 3300018481|Ga0190271_11713085 | Not Available | 742 | Open in IMG/M |
| 3300019377|Ga0190264_12355205 | Not Available | 502 | Open in IMG/M |
| 3300020167|Ga0194035_1010666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3795 | Open in IMG/M |
| 3300021170|Ga0210400_10090711 | Not Available | 2411 | Open in IMG/M |
| 3300021171|Ga0210405_10065476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2868 | Open in IMG/M |
| 3300021432|Ga0210384_11833430 | Not Available | 512 | Open in IMG/M |
| 3300022886|Ga0247746_1062990 | Not Available | 868 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10212259 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025926|Ga0207659_10561504 | Not Available | 971 | Open in IMG/M |
| 3300025941|Ga0207711_10017227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6005 | Open in IMG/M |
| 3300025949|Ga0207667_10495374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1240 | Open in IMG/M |
| 3300026075|Ga0207708_10631331 | Not Available | 910 | Open in IMG/M |
| 3300026535|Ga0256867_10345428 | Not Available | 520 | Open in IMG/M |
| 3300026552|Ga0209577_10273427 | Not Available | 1268 | Open in IMG/M |
| 3300026557|Ga0179587_11051965 | Not Available | 536 | Open in IMG/M |
| 3300027835|Ga0209515_10073361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2437 | Open in IMG/M |
| 3300027903|Ga0209488_10125521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1933 | Open in IMG/M |
| 3300027907|Ga0207428_10749895 | Not Available | 696 | Open in IMG/M |
| 3300028381|Ga0268264_10382615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1348 | Open in IMG/M |
| 3300028906|Ga0308309_11396542 | Not Available | 600 | Open in IMG/M |
| 3300030990|Ga0308178_1095927 | Not Available | 623 | Open in IMG/M |
| 3300030990|Ga0308178_1143139 | Not Available | 544 | Open in IMG/M |
| 3300031057|Ga0170834_112860677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 706 | Open in IMG/M |
| 3300031099|Ga0308181_1087444 | Not Available | 655 | Open in IMG/M |
| 3300031229|Ga0299913_10966410 | Not Available | 819 | Open in IMG/M |
| 3300031424|Ga0308179_1049572 | Not Available | 543 | Open in IMG/M |
| 3300031455|Ga0307505_10268462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 796 | Open in IMG/M |
| 3300031474|Ga0170818_103425049 | Not Available | 776 | Open in IMG/M |
| 3300031562|Ga0310886_10060682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1753 | Open in IMG/M |
| 3300031716|Ga0310813_11931172 | Not Available | 556 | Open in IMG/M |
| 3300031965|Ga0326597_11382512 | Not Available | 683 | Open in IMG/M |
| 3300034268|Ga0372943_0577295 | Not Available | 737 | Open in IMG/M |
| 3300034644|Ga0370548_028259 | Not Available | 902 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.45% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 4.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.64% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.91% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.91% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.91% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.91% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Micrasterias Crux-Melitensis (Mzch 98) Associated | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Micrasterias Crux-Melitensis (Mzch 98) Associated | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003312 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P1 sample | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300008886 | Microbial communities associated with unicellular green alga Micrasterias crux-melitensis, Germany - (MZCH: 98) | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_04493460 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MKDFSMTTVPVSASEPHEARTPATPQQQTQGNPPKPADKPIEQQK |
| C688J18823_101991103 | 3300001686 | Soil | MTAVPISASEPQKPATPATPQQQTQANPPKPTDKPSEQQK* |
| C688J35102_1177005242 | 3300002568 | Soil | MTTVPISASEPQTPATPATPQQQTQGNPPKPADKPSEQQK* |
| P12013IDBA_10363304 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | MTNVNLSTEEKKPANPPASPQQTQGNPPKPAEKPAEQQK* |
| Ga0055467_100620671 | 3300003996 | Natural And Restored Wetlands | MTNVTISASEPQKPASPAPATPRQQTQGTPSKPADKPNEQQK* |
| Ga0055472_102562932 | 3300003998 | Natural And Restored Wetlands | MSNVNISASEQQKPANPAPATPQQQTQGNPPKPADKAGEQQK* |
| Ga0055485_100242424 | 3300004067 | Natural And Restored Wetlands | MTNIPVSASNNEQKPSTPANPQQQTQNNPPKPADKPSEQQK* |
| Ga0063454_1008376031 | 3300004081 | Soil | MTTVPVSASEPQKPATPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0062384_1005256691 | 3300004082 | Bog Forest Soil | MTNTPNSVSGDQKPATPANPQQQTQNPPKPADKPSEQQK* |
| Ga0063455_1003040182 | 3300004153 | Soil | MTTVPVSASEPQKPATPTTPQQQTQGNPPKPADKPSEQQK* |
| Ga0062590_1001041524 | 3300004157 | Soil | MTIINITASNEPQKPANPAPATPQQTQGTPSKPADKPSEQQK* |
| Ga0062590_1001967192 | 3300004157 | Soil | MTTVPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSEQQK* |
| Ga0062595_1006142652 | 3300004479 | Soil | MKGNTMTNVNITATNEPQKPANPAPATPQQQTQGNPAKPADKPSEQQK* |
| Ga0070658_117001761 | 3300005327 | Corn Rhizosphere | MTNIPVSASDDTVKPATPVTPQQQTQGNPPKPADKPSEQQK* |
| Ga0070690_1008197102 | 3300005330 | Switchgrass Rhizosphere | MTTVPVSASEPQKPATPATPQQQTQGNPPKPADKPIEQQK* |
| Ga0070691_104107582 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTVPVSAAEPQTPATPATPQQQTQSNPPKPADKPSEQQK* |
| Ga0070709_104910332 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNVTNSASDPQKPAAPATPQQQTQSNPQPQGSPAKPADKPSEQQK* |
| Ga0070709_110499892 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTVPISASEPQKPANPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0066689_109402752 | 3300005447 | Soil | MTNVPISASEPQKPANPAPATPQQQTQGNPNPKPVDKPSEQQK* |
| Ga0070698_1008635543 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSAKDITMTNVPISASEPQKPAAPAPATPQQQTQANPKPVEKPAEQQK* |
| Ga0070672_1007746322 | 3300005543 | Miscanthus Rhizosphere | MTNASEQEKPATPAPTPQQQTQGNPPKPADKPSEQQK* |
| Ga0070686_1007023394 | 3300005544 | Switchgrass Rhizosphere | KDFSMTIVPVSASEPQKPATPATPQQQTQGNPPKPADKPIEQQK* |
| Ga0070665_1001683904 | 3300005548 | Switchgrass Rhizosphere | MTTVPVSASEPQAPATPQQQTHATPPNPADKPSEQQK* |
| Ga0068855_1005901541 | 3300005563 | Corn Rhizosphere | MTDFKISGSTEQKPVNNPAPANPQQTQANPPKTDNKPSEQQK* |
| Ga0068854_1019743272 | 3300005578 | Corn Rhizosphere | VNITASNEPQKPTPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0068852_1014591032 | 3300005616 | Corn Rhizosphere | MTDIKISGSTEQKPVNNPAPANPQQTQANPPKTDNKPSEQQK* |
| Ga0068858_1011430223 | 3300005842 | Switchgrass Rhizosphere | MTIVPVSASEPQKPATPVTPQQQTQGNPPKPADKPSEQQK* |
| Ga0068858_1012404591 | 3300005842 | Switchgrass Rhizosphere | VSAAEPQAPTTPASPQQQTQANPPKPADKPSEQQK* |
| Ga0070717_103084012 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNVTNSASDSQKPAAPATPQQQTQSNPQPQGSPAKPADKPSEQQK* |
| Ga0066652_1003937271 | 3300006046 | Soil | KDIAMTNVPISASEPQKPASPAPATPQQQTQANPKPVEKLAQQQK* |
| Ga0075024_1001530142 | 3300006047 | Watersheds | MTTVPISASEPQKPATPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0075024_1006185883 | 3300006047 | Watersheds | KRFFYMTNAPVSAFNDTPKPATPAPRQQQTQTNPPKPADKPSEQQK* |
| Ga0075363_1004434652 | 3300006048 | Populus Endosphere | MTTVPVSTSEPQTPATPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0075367_101659802 | 3300006178 | Populus Endosphere | MTTVPVSAAEPQAPTTPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0075367_103893084 | 3300006178 | Populus Endosphere | MTMTDVKISTSTEQKPATTPAPATPQQQTQSNPPKTGDKPNEQQK* |
| Ga0075367_109231223 | 3300006178 | Populus Endosphere | MTIVPVSASEPQKPATPVTPQQQTQGNPPKPADKPGEQQK* |
| Ga0075370_106091492 | 3300006353 | Populus Endosphere | MTIVPVSASEPQKPATPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0066653_103046581 | 3300006791 | Soil | MTNVPISASEPQKPASPAPATPQQQTQANPKPVEKLAQQQSKLA |
| Ga0075428_1010047212 | 3300006844 | Populus Rhizosphere | MTNVSINASNEPQKPTTPASTPTPQQQTQGTPKPASDKPSEQQK* |
| Ga0075425_1018469642 | 3300006854 | Populus Rhizosphere | MTTVPVSASEPQKPASPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0068865_1013349331 | 3300006881 | Miscanthus Rhizosphere | VPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSEQQK* |
| Ga0075424_1015936482 | 3300006904 | Populus Rhizosphere | MTNVPISASEPQKPASPAPATPQQQTQDNPKPATKPAEQQK* |
| Ga0115930_10358863 | 3300008886 | Micrasterias Crux-Melitensis (Mzch 98) Associated | MTNIPVTASGDQKPETPATPQQQTQNPPKPADKPSEQQK* |
| Ga0066710_1025343892 | 3300009012 | Grasslands Soil | MTNVPISASEPQKPANPAPATPQQQTQGNPNPKPVD |
| Ga0066710_1033827401 | 3300009012 | Grasslands Soil | DTTTMTNVPISASEPQKPANPAPATPQQQTQGNPNPKPVDKPSEQQK |
| Ga0105095_100712873 | 3300009053 | Freshwater Sediment | MTNVTISASEFQKPASRAPATPQQQTQGTPVKPADKPSEQQK* |
| Ga0111539_108903994 | 3300009094 | Populus Rhizosphere | MTNTPVANNDPKPATPATPQQQNQGTPKPADKPSEQQK* |
| Ga0105245_113502892 | 3300009098 | Miscanthus Rhizosphere | MTNVPVSGSNPDQKPSTPATPQQQTQANPPKPADKPSEQQK* |
| Ga0105245_118075473 | 3300009098 | Miscanthus Rhizosphere | VFRKGNTMTNVNITASNEPQKPTPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0105245_129661891 | 3300009098 | Miscanthus Rhizosphere | MTTVPVSASEPQKPATPATPQQQTQGNPPKPVDKPSEQQK* |
| Ga0105237_120159651 | 3300009545 | Corn Rhizosphere | MKGFSMTTVPISASEPQKPATPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0105249_102188012 | 3300009553 | Switchgrass Rhizosphere | MTTVPVSAAEPQTPATPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0099796_102783282 | 3300010159 | Vadose Zone Soil | MTTVPVSASEPQKPATPATPQQQTQGNPPKPADKPNEQQK* |
| Ga0134125_105310135 | 3300010371 | Terrestrial Soil | MTDVKISASTEQKPANNPAPATPQQTQTNPPKTDNKPSEQQK* |
| Ga0105239_115479162 | 3300010375 | Corn Rhizosphere | MITVPVSAAEPQAPTTPASPQQQTQANPPKPADKPSEQQK* |
| Ga0134126_104540383 | 3300010396 | Terrestrial Soil | MTNVTNSASDPQKPATQAPATPQQQTQSNPQPAKPADKPSEQQK* |
| Ga0134122_103930802 | 3300010400 | Terrestrial Soil | MTTVPVSAAEPQTPATPATPQQQTQGNPPKPADKPIEQQK* |
| Ga0137442_11085372 | 3300011414 | Soil | MTNVTISASEPQKPASAAPVTPQQQTQGAPAKSADKPSEQQK* |
| Ga0150985_1025187973 | 3300012212 | Avena Fatua Rhizosphere | SFHKKDMTMTNIPVSASDDTVKPATPVTPQQQTQGNPPKPADKPSEQQK* |
| Ga0137449_11039172 | 3300012227 | Soil | MMNVTISASEPPKPASPAPVTMQQQTEGAPAKPADKPSEQQN* |
| Ga0137366_109801412 | 3300012354 | Vadose Zone Soil | MTNAPVPSSGDQKPATPATPQQQTQTNPPKPADKPSEQQK* |
| Ga0150984_1009035481 | 3300012469 | Avena Fatua Rhizosphere | NKSQVILKGITMTDPIRVPVTASGDNKPSTPATPQQQTQGNPPKPADKPSEQQK* |
| Ga0137407_105671951 | 3300012930 | Vadose Zone Soil | IPVTASSDQKPATPATPQQQTQAPAPKPADKPNEQQK* |
| Ga0164303_111133711 | 3300012957 | Soil | TVPISASEPQKPTTPAPQQQTQGNPPKPADKPIEQQK* |
| Ga0164302_101722222 | 3300012961 | Soil | MTTVPVSAAEPQTPATQATPQQQTQGNPPKPADKPSEQQK* |
| Ga0164309_110835042 | 3300012984 | Soil | MTTVPIAASEPQKPATLSPAVTPQQQTQGNPPKPADKPSEQQK* |
| Ga0075325_10131082 | 3300014270 | Natural And Restored Wetlands | MTNVNISASEPQKPANPSPATPQQQTQGSPAKPADKPGEQQK* |
| Ga0075331_10786102 | 3300014310 | Natural And Restored Wetlands | MTNVNISASEPQKPANPSPATPQQQTQGTPAKPTDKPGEQQK* |
| Ga0075355_11154242 | 3300014322 | Natural And Restored Wetlands | MYSKNKTQVFLKGITMTDPIIVPVSASGDNKPATPTTPQQQTQANPPKPADKPSEQQK* |
| Ga0167637_10033112 | 3300015087 | Glacier Forefield Soil | MTDTPVTGSTPEQKPAAAPATPQQQNQGSPKPADTKPNEQQK* |
| Ga0137409_111900931 | 3300015245 | Vadose Zone Soil | NVPISASEPQKPASPAPATPQQQTQGNPKPADKPSEQQK* |
| Ga0163161_111851151 | 3300017792 | Switchgrass Rhizosphere | HDKDISMTNASEQEKPATPAPTPQQQTQGNPPKPADKPSEQQK |
| Ga0190266_100119733 | 3300017965 | Soil | MTNASEQEKPATPAPTPQQQTQGNPPKPADKPSEQQK |
| Ga0190266_105940621 | 3300017965 | Soil | MTNIPVSASNNEQKPATPATPQQQTQSNPPKPADKPSEQQK |
| Ga0190266_106825202 | 3300017965 | Soil | MTDVKISASEPQKPATPATAPATPQQQNQGTPKPADKPSEQQK |
| Ga0187805_102788722 | 3300018007 | Freshwater Sediment | MVFRYFSKEFTMTNMPNSSNDQESVTSPTPQQQTQNNPPKPADKPVEQQK |
| Ga0190270_133636191 | 3300018469 | Soil | MTNIPVSASSNEQKPATPATPQQQTQGNPPKPADKPSEQQK |
| Ga0190271_117130852 | 3300018481 | Soil | MTNIPVTASGNEQKPVTPANPQQQTQGNPPKPADKPSEQQK |
| Ga0190264_123552051 | 3300019377 | Soil | MTNTPAFANDEKKPATPATPQQNQGAPKPAEKQGEQQK |
| Ga0194035_10106663 | 3300020167 | Anoxic Zone Freshwater | MTNVPVSGSTPEQKPAVAPATPQQQTQGTPKPAETAKPNEQQK |
| Ga0210400_100907114 | 3300021170 | Soil | MTNVKISAFEPQKPVDPTPATPQQQTQSNPQKPAGKPGEQQK |
| Ga0210405_100654763 | 3300021171 | Soil | MTSVTISASEPQKPANPTPATPQQQTQSNPTKPLDKPNEQQK |
| Ga0210384_118334301 | 3300021432 | Soil | MTNVKISASEPQKPADPTAAAPQQQTQSNPQKPAGKPGEQQK |
| Ga0247746_10629901 | 3300022886 | Soil | MTTVPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSEQQK |
| (restricted) Ga0233424_102122592 | 3300023208 | Freshwater | LVATGAIAMTNVNLSTKEKKPANPPASPQQTQGNPPKPAEKPAEQQK |
| Ga0207659_105615041 | 3300025926 | Miscanthus Rhizosphere | MTTVPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSE |
| Ga0207711_100172277 | 3300025941 | Switchgrass Rhizosphere | MTTVPVSASEPQKPATPATPQQQTQGNPPKPADKPIEQQK |
| Ga0207667_104953745 | 3300025949 | Corn Rhizosphere | MTDFKISGSTEQKPVNNPAPANPQQTQANPPKTDNKPSEQQK |
| Ga0207708_106313312 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTVPVSAAEPQTPATPATPQQQTQGNPPKPADKPSEQQK |
| Ga0256867_103454281 | 3300026535 | Soil | MTNVNISASEPQKPANPSPATPQQQTQGNPAKPADKPGEQQK |
| Ga0209577_102734272 | 3300026552 | Soil | MTNVPISASEPQKPANPAPATPQQQTQGNPNPKPVDKPSEQQK |
| Ga0179587_110519651 | 3300026557 | Vadose Zone Soil | MTSIPISASEPQKPASPTPATPQQQTQANPKPADKPVQQQK |
| Ga0209515_100733615 | 3300027835 | Groundwater | MTNAPVANSDPKPATPASPQQQTQGTPPKPADKPSEQQK |
| Ga0209488_101255212 | 3300027903 | Vadose Zone Soil | MTNVPISASEPQKPASPAPATPQQQTQANPKPVEKPAQQQK |
| Ga0207428_107498953 | 3300027907 | Populus Rhizosphere | MTNVTISASEPQKPATPAPATPQQQTQAAPKPADKPSEQQK |
| Ga0268264_103826151 | 3300028381 | Switchgrass Rhizosphere | MTTVPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSEQQ |
| Ga0308309_113965422 | 3300028906 | Soil | ISASEPQKPADPTPAIPQQQTQSNLQKPAGKPGEQQK |
| Ga0308178_10959272 | 3300030990 | Soil | MTDVKISASAEQKPANNPAPATPQQQTQANPPKPADKPSDQQK |
| Ga0308178_11431393 | 3300030990 | Soil | GNTMTIINITSSNEPQKPANPAPAMPQQTQGTPSKPADKPSEQQK |
| Ga0170834_1128606771 | 3300031057 | Forest Soil | MTNVTISASEPQKPTNPTPATPQQQTQDNPAKPADKPAQQQK |
| Ga0308181_10874441 | 3300031099 | Soil | NVTISANEPQKPANPSQATPQQQTQGNPPKPADKPEQQK |
| Ga0299913_109664101 | 3300031229 | Soil | MTNVNISASEPQKPANPSPATPQQQTQGTPAKPTDKPGEQQK |
| Ga0308179_10495721 | 3300031424 | Soil | TISANEPHKPSNPSQATNQQQTQGNPPKPADKPEQQK |
| Ga0307505_102684622 | 3300031455 | Soil | MTNIPVSNSTPEQKPATPAAPQQTQGNPPKPADKPNEQQK |
| Ga0170818_1034250491 | 3300031474 | Forest Soil | MTTVQISASEPQKPATPATPQQQTQGNPPKPADKPSEQQK |
| Ga0310886_100606824 | 3300031562 | Soil | VTIINITASNEPQKPANLAPATPQQTQGTPSKPADKPSEQQK |
| Ga0310813_119311722 | 3300031716 | Soil | VLNLFIKDITVTNISITASESQKPATPSPTTPQQQTQGNPPKPADKPSEQ |
| Ga0326597_113825121 | 3300031965 | Soil | MTNVVISASEPQKPANPAPATPQQQTQGNPKPAEKQGEQQK |
| Ga0372943_0577295_506_628 | 3300034268 | Soil | MTNVPISASDPQKPATPATPQQQTQGNPPKPADKPSEQQK |
| Ga0370548_028259_25_153 | 3300034644 | Soil | MTNVTISANEPQKPANPSQATPQQQTQGNPPKPADKPSEQQK |
| ⦗Top⦘ |