


| Basic Information | |
|---|---|
| Family ID | F087397 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RLLKKAHLRRWPARALAAAYPEYASLGASRAALHLDLFEQPG |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.00 % |
| % of genes near scaffold ends (potentially truncated) | 83.64 % |
| % of genes from short scaffolds (< 2000 bps) | 81.82 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (21.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (35.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 4.55 |
| PF00528 | BPD_transp_1 | 3.64 |
| PF13470 | PIN_3 | 2.73 |
| PF13561 | adh_short_C2 | 1.82 |
| PF00496 | SBP_bac_5 | 1.82 |
| PF00892 | EamA | 1.82 |
| PF07045 | DUF1330 | 1.82 |
| PF01012 | ETF | 1.82 |
| PF06826 | Asp-Al_Ex | 1.82 |
| PF00106 | adh_short | 0.91 |
| PF00730 | HhH-GPD | 0.91 |
| PF05635 | 23S_rRNA_IVP | 0.91 |
| PF00456 | Transketolase_N | 0.91 |
| PF14833 | NAD_binding_11 | 0.91 |
| PF01455 | HupF_HypC | 0.91 |
| PF02567 | PhzC-PhzF | 0.91 |
| PF01242 | PTPS | 0.91 |
| PF00293 | NUDIX | 0.91 |
| PF00994 | MoCF_biosynth | 0.91 |
| PF00534 | Glycos_transf_1 | 0.91 |
| PF13183 | Fer4_8 | 0.91 |
| PF02775 | TPP_enzyme_C | 0.91 |
| PF10609 | ParA | 0.91 |
| PF03948 | Ribosomal_L9_C | 0.91 |
| PF00155 | Aminotran_1_2 | 0.91 |
| PF03480 | DctP | 0.91 |
| PF00578 | AhpC-TSA | 0.91 |
| PF00301 | Rubredoxin | 0.91 |
| PF02771 | Acyl-CoA_dh_N | 0.91 |
| PF01656 | CbiA | 0.91 |
| PF02163 | Peptidase_M50 | 0.91 |
| PF12327 | FtsZ_C | 0.91 |
| PF03279 | Lip_A_acyltrans | 0.91 |
| PF01264 | Chorismate_synt | 0.91 |
| PF01435 | Peptidase_M48 | 0.91 |
| PF14486 | DUF4432 | 0.91 |
| PF13785 | DUF4178 | 0.91 |
| PF00389 | 2-Hacid_dh | 0.91 |
| PF02826 | 2-Hacid_dh_C | 0.91 |
| PF12848 | ABC_tran_Xtn | 0.91 |
| PF05163 | DinB | 0.91 |
| PF01565 | FAD_binding_4 | 0.91 |
| PF02405 | MlaE | 0.91 |
| PF01408 | GFO_IDH_MocA | 0.91 |
| PF02662 | FlpD | 0.91 |
| PF06792 | UPF0261 | 0.91 |
| PF00248 | Aldo_ket_red | 0.91 |
| PF00749 | tRNA-synt_1c | 0.91 |
| PF13145 | Rotamase_2 | 0.91 |
| PF16661 | Lactamase_B_6 | 0.91 |
| PF02776 | TPP_enzyme_N | 0.91 |
| PF14535 | AMP-binding_C_2 | 0.91 |
| PF01261 | AP_endonuc_2 | 0.91 |
| PF02700 | PurS | 0.91 |
| PF00691 | OmpA | 0.91 |
| PF01022 | HTH_5 | 0.91 |
| PF14602 | Hexapep_2 | 0.91 |
| PF04074 | DUF386 | 0.91 |
| PF04519 | Bactofilin | 0.91 |
| PF00069 | Pkinase | 0.91 |
| PF00933 | Glyco_hydro_3 | 0.91 |
| PF07883 | Cupin_2 | 0.91 |
| PF08240 | ADH_N | 0.91 |
| PF02899 | Phage_int_SAM_1 | 0.91 |
| PF03755 | YicC_N | 0.91 |
| PF02823 | ATP-synt_DE_N | 0.91 |
| PF01182 | Glucosamine_iso | 0.91 |
| PF01969 | Ni_insertion | 0.91 |
| PF01425 | Amidase | 0.91 |
| PF02653 | BPD_transp_2 | 0.91 |
| PF02580 | Tyr_Deacylase | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.64 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 1.82 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 1.82 |
| COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 1.82 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.82 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.91 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.91 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.91 |
| COG1490 | D-aminoacyl-tRNA deacylase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.91 |
| COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG1641 | CTP-dependent cyclometallase, nickel-pincer nucleotide (NPN) cofactor biosynthesis | Coenzyme transport and metabolism [H] | 0.91 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.91 |
| COG1828 | Phosphoribosylformylglycinamidine (FGAM) synthase, PurS subunit | Nucleotide transport and metabolism [F] | 0.91 |
| COG1908 | Coenzyme F420-reducing hydrogenase, delta subunit | Energy production and conversion [C] | 0.91 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.91 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.91 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.91 |
| COG2731 | Beta-galactosidase, beta subunit | Carbohydrate transport and metabolism [G] | 0.91 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.91 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.91 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.91 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.91 |
| COG5441 | ATP-binding helicase-inhibiting domain, Tm-1/UPF0261 family | Defense mechanisms [V] | 0.91 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.91 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.91 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.91 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.91 |
| COG0298 | Hydrogenase maturation factor HybG, HypC/HupF family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.91 |
| COG0359 | Ribosomal protein L9 | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.91 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.91 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.91 |
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.18 % |
| Unclassified | root | N/A | 31.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918008|ConsensusfromContig363523 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300004058|Ga0055498_10123976 | Not Available | 544 | Open in IMG/M |
| 3300004282|Ga0066599_101063741 | Not Available | 594 | Open in IMG/M |
| 3300004481|Ga0069718_15827399 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 1474 | Open in IMG/M |
| 3300004778|Ga0062383_10023279 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300004778|Ga0062383_10650049 | Not Available | 537 | Open in IMG/M |
| 3300004779|Ga0062380_10256399 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
| 3300004782|Ga0062382_10631965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium RBG_16_65_8 | 526 | Open in IMG/M |
| 3300005263|Ga0071346_1267784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300005830|Ga0074473_10429124 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005833|Ga0074472_10876460 | All Organisms → cellular organisms → Bacteria | 3956 | Open in IMG/M |
| 3300006224|Ga0079037_100220992 | Not Available | 1715 | Open in IMG/M |
| 3300006224|Ga0079037_100502146 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300006224|Ga0079037_101413675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300009037|Ga0105093_10208661 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300009039|Ga0105152_10307549 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300009039|Ga0105152_10463437 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009085|Ga0105103_10015794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3674 | Open in IMG/M |
| 3300009091|Ga0102851_10305436 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300009091|Ga0102851_11682599 | Not Available | 712 | Open in IMG/M |
| 3300009111|Ga0115026_10810570 | Not Available | 733 | Open in IMG/M |
| 3300009111|Ga0115026_11314848 | Not Available | 594 | Open in IMG/M |
| 3300009146|Ga0105091_10431952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300009157|Ga0105092_10505718 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300009157|Ga0105092_10840334 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009166|Ga0105100_10323383 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300009167|Ga0113563_12066500 | Not Available | 682 | Open in IMG/M |
| 3300009168|Ga0105104_10486644 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300009170|Ga0105096_10304303 | Not Available | 814 | Open in IMG/M |
| 3300009179|Ga0115028_10081729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1765 | Open in IMG/M |
| 3300009179|Ga0115028_10128376 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300009179|Ga0115028_11342229 | Not Available | 598 | Open in IMG/M |
| 3300010412|Ga0136852_10973190 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300011340|Ga0151652_13600553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1036 | Open in IMG/M |
| 3300011407|Ga0137450_1089223 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300011408|Ga0137460_1122976 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012931|Ga0153915_12494794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 605 | Open in IMG/M |
| 3300012964|Ga0153916_12954571 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300014306|Ga0075346_1168968 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300014494|Ga0182017_10332355 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300014498|Ga0182019_10624391 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300014498|Ga0182019_11443049 | Not Available | 511 | Open in IMG/M |
| 3300014502|Ga0182021_10673130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1240 | Open in IMG/M |
| 3300014502|Ga0182021_11309258 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → Candidatus Methylomirabilis → Candidatus Methylomirabilis oxyfera | 873 | Open in IMG/M |
| 3300014502|Ga0182021_11364242 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300014502|Ga0182021_11832715 | Not Available | 730 | Open in IMG/M |
| 3300014502|Ga0182021_13143077 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300014839|Ga0182027_10255403 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300014839|Ga0182027_10759278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1020 | Open in IMG/M |
| 3300017939|Ga0187775_10181421 | Not Available | 770 | Open in IMG/M |
| 3300017959|Ga0187779_10788648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300017961|Ga0187778_10205082 | Not Available | 1257 | Open in IMG/M |
| 3300017961|Ga0187778_10716106 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300017972|Ga0187781_10873987 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018058|Ga0187766_10019438 | All Organisms → cellular organisms → Bacteria | 3892 | Open in IMG/M |
| 3300018086|Ga0187769_10044344 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
| 3300023311|Ga0256681_12199886 | Not Available | 627 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10307480 | Not Available | 701 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10375353 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300024056|Ga0124853_1200379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 2350 | Open in IMG/M |
| 3300025865|Ga0209226_10247511 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300027715|Ga0208665_10096131 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300027831|Ga0209797_10077617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1462 | Open in IMG/M |
| 3300027843|Ga0209798_10272648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300027890|Ga0209496_10071691 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300027890|Ga0209496_10119286 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300027890|Ga0209496_10206533 | Not Available | 937 | Open in IMG/M |
| 3300027975|Ga0209391_10268558 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300028069|Ga0255358_1064363 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031726|Ga0302321_100219094 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300031834|Ga0315290_11410050 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300032164|Ga0315283_12423428 | Not Available | 510 | Open in IMG/M |
| 3300032173|Ga0315268_12682603 | Not Available | 512 | Open in IMG/M |
| 3300032177|Ga0315276_12009815 | Not Available | 590 | Open in IMG/M |
| 3300032256|Ga0315271_10617529 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300032401|Ga0315275_10388602 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300032516|Ga0315273_10067525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Caldilineae → Caldilineales → Caldilineaceae → Caldilinea → Caldilinea aerophila | 4855 | Open in IMG/M |
| 3300032770|Ga0335085_11559329 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300032782|Ga0335082_11278625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300033158|Ga0335077_11289470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 710 | Open in IMG/M |
| 3300033408|Ga0316605_10777608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 909 | Open in IMG/M |
| 3300033413|Ga0316603_11281807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300033414|Ga0316619_10176610 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300033414|Ga0316619_11909992 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300033416|Ga0316622_100816438 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium RBG_16_65_8 | 1084 | Open in IMG/M |
| 3300033416|Ga0316622_102870658 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300033418|Ga0316625_100643980 | Not Available | 875 | Open in IMG/M |
| 3300033419|Ga0316601_100009177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5888 | Open in IMG/M |
| 3300033433|Ga0326726_11057113 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300033433|Ga0326726_11166937 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300033482|Ga0316627_100924639 | Not Available | 838 | Open in IMG/M |
| 3300033483|Ga0316629_10183510 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300033483|Ga0316629_10824702 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300033485|Ga0316626_10043267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 3021 | Open in IMG/M |
| 3300033513|Ga0316628_101089858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 1062 | Open in IMG/M |
| 3300033513|Ga0316628_102632796 | Not Available | 663 | Open in IMG/M |
| 3300033521|Ga0316616_102336950 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300033521|Ga0316616_102482903 | Not Available | 695 | Open in IMG/M |
| 3300033805|Ga0314864_0151409 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300033806|Ga0314865_093621 | Not Available | 786 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 21.82% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 9.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.18% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 8.18% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.18% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 7.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.36% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 5.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.82% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.82% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.82% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.82% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.82% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.82% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.82% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.82% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.91% |
| Anaerobic Enrichment Culture | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.91% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.91% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.91% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005263 | Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3 | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300011407 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2 | Environmental | Open in IMG/M |
| 3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Bog_all_C_03284980 | 2140918008 | Soil | LKKAHLRRWNAQALVAAYLEYASLGPSRAALHLDLFEQPGKKVVSSFDSGSD |
| Ga0055498_101239761 | 3300004058 | Natural And Restored Wetlands | LLKKAHLRRWPARALVAACLKYASLGPARAALHPDLFEQPGQM* |
| Ga0066599_1010637412 | 3300004282 | Freshwater | LLKKAHLLRWHARALAAAYLKYASLGPLRAALHLDLFEQPG* |
| Ga0069718_158273993 | 3300004481 | Sediment | LLKKAHLRRWPASPLAAAYVQYASLGLRRAALHLGLFEQPG* |
| Ga0062383_100232791 | 3300004778 | Wetland Sediment | MYPPLRLLKKAHLLCWLTWALVAAYLEYASLGPSRAALQLDLFE* |
| Ga0062383_106500492 | 3300004778 | Wetland Sediment | MLLKKAHLLRRSALVTAAYNSYASFLRSSQALHLDLFEQPAR* |
| Ga0062380_102563991 | 3300004779 | Wetland Sediment | LKKAHLRRWRARALVAAYLEYASLGASLAALHLVLFEQPGKKRVLR* |
| Ga0062382_106319652 | 3300004782 | Wetland Sediment | RLLKKAHLLRWRARALVAAYLEYASLGPLPAAWHLGLFEQPGRARVFP* |
| Ga0071346_12677843 | 3300005263 | Anaerobic Enrichment Culture | LLKKAHLRRWNAWALIAAYLEYASLGPAHSALHLDLLEQPGR |
| Ga0074473_104291241 | 3300005830 | Sediment (Intertidal) | GSRLLKKAHLLRWHARALAAAYLKYASLGLLRAALHLDLFEQPG* |
| Ga0074472_108764606 | 3300005833 | Sediment (Intertidal) | AEKAHLLRWSACALVAAYPMYASLGPSHAALHLGLFEQSDGRRL* |
| Ga0079037_1002209922 | 3300006224 | Freshwater Wetlands | VAFGIAFSFTRLLKKAQLRRWSALPLAATYFQYASLGHRPSALHLSLFEPP |
| Ga0079037_1005021461 | 3300006224 | Freshwater Wetlands | LKKAHLRRWPARALVAAYLEYASLGPSRAALHLDP* |
| Ga0079037_1014136751 | 3300006224 | Freshwater Wetlands | RLLKKAHLRRWLTRALVAAYLEYASLGPARAALHLDL* |
| Ga0079037_1018900051 | 3300006224 | Freshwater Wetlands | RLLKKAHLRRWLTRALVAAYLEYASLGPACAALQLDLFEQPDQKRAF* |
| Ga0079303_101058421 | 3300006930 | Deep Subsurface | MVLPPFRLLKKAHLRRWRTRALLAAYLEYASLGPARAALH |
| Ga0105093_102086611 | 3300009037 | Freshwater Sediment | KKAHLRRWLSWALAAAYLEYASLGPVCAALHLDLF* |
| Ga0105152_103075491 | 3300009039 | Lake Sediment | HLRRWKAEALVAAYPEYASLGLAPSALHLDRFEQPAEK* |
| Ga0105152_104634371 | 3300009039 | Lake Sediment | MASSRLLKKAHLRRWRAGALAAAYRKYASLGPARAAWHLDLFEQPG |
| Ga0105103_100157944 | 3300009085 | Freshwater Sediment | MLLKTAHLRRWPASPLAAAYLQYASLGRQRAALHLDRFEQPG* |
| Ga0102851_103054361 | 3300009091 | Freshwater Wetlands | MAHLLRWLTRALVAAYLEYASLGPACAALHLGLFEQP |
| Ga0102851_116825991 | 3300009091 | Freshwater Wetlands | RWSASPLAAAYFQYASLGLQHSALHLDLFEQPVRKIIL* |
| Ga0115026_108105701 | 3300009111 | Wetland | RLLKKAHLRRWHASALAAAYPQYASLGLCRAALHLGLFEQPAE* |
| Ga0115026_113148481 | 3300009111 | Wetland | EKAHPRRWLTPALVAAYLEYASLGPTCAALRLDLFEQPGQNPFFVI* |
| Ga0105091_104319521 | 3300009146 | Freshwater Sediment | LLKKAQLLRWRARALAAAYREYASLGPSLAALHLDLFEQPGRE* |
| Ga0105092_105057181 | 3300009157 | Freshwater Sediment | MGTNRLLKKAHLRRWRPCALAAAYLEYASLGTSCAALHLNLFEQPARKRFGST |
| Ga0105092_108403341 | 3300009157 | Freshwater Sediment | KKAYLRRWRASALAAAYLQYACTQQTGYPGLRRAALHLGLFEQPDQIEVFRN* |
| Ga0105100_103233832 | 3300009166 | Freshwater Sediment | MSVPLDVIRLLKKAHLRRWRASALAATYLQYASLGLWHAALHPDLF* |
| Ga0113563_120665002 | 3300009167 | Freshwater Wetlands | RLLKKAHLLRWLARALVAAYQKYASLGLLRAALHLDLFEQPFSKRVL* |
| Ga0105104_104866443 | 3300009168 | Freshwater Sediment | VRLLKTAHLPRWRACALAAAYLEYASLGASHAALHLDRFEQ |
| Ga0105096_103043031 | 3300009170 | Freshwater Sediment | KKAHLLRCRAWALAAAYLEYASLGPVRGASHLDLF* |
| Ga0115028_100817291 | 3300009179 | Wetland | LKKAHLLRWPTSPLAAAYLQYASLGLRRTALHLDLFEQPDQKTGSLAIY* |
| Ga0115028_101283761 | 3300009179 | Wetland | LKKAHLRRWRASALAATYLQYASLDLWRAALHLDLFEQPGRASCSCAFPP* |
| Ga0115028_113422291 | 3300009179 | Wetland | PNRLLKKAHLLRWLARALAAAYLEYASLGPARAALHLDLFEQPAR* |
| Ga0136852_109731902 | 3300010412 | Mangrove Sediment | SNNRLLKTVHLRRWRARALAAAYLKYASLGPSLAALYLDRFEQPG* |
| Ga0151652_136005531 | 3300011340 | Wetland | MLARLLKKAHLLRWRAGALAAAYRKYASLGPALAVLHLDLFEQPGRKW |
| Ga0137450_10892232 | 3300011407 | Soil | GMNTPDRLLKKAHLPRWPASPLAAAYLQYASLGLRHAALHLDLFEQPARK* |
| Ga0137460_11229762 | 3300011408 | Soil | VSRRLLKKAHLLRSPASPLAAAYFQYASLGLRRAALHLGLFEQPE* |
| Ga0153915_124947942 | 3300012931 | Freshwater Wetlands | LGRLLKKAHLRRWPASALTAAYLQYASLGLWRAALHLDLFEQPGE* |
| Ga0153916_129545711 | 3300012964 | Freshwater Wetlands | VASPGRRLKKAHPLRWHAWALVAAYLEYASLGPSRAALRLDLFEPPGQIELFGVRP |
| Ga0075346_11689681 | 3300014306 | Natural And Restored Wetlands | VKNRLLKKAHLRRWRAWALVAAYRKYASLGPSLAAWHLDLF |
| Ga0182017_103323551 | 3300014494 | Fen | RLLKKIHLLRWPAWALAAAYLEYASLGPSRAALHLDLFEQPADI* |
| Ga0182019_106243911 | 3300014498 | Fen | GSSPNRLLKKAHLRRWNAQALAAAYLEYASLGLPHSALHLDLFEQPE* |
| Ga0182019_114430491 | 3300014498 | Fen | RWNAQALVAAYLEYASLGLPHSALHLDLFEQPAEE* |
| Ga0182021_106731302 | 3300014502 | Fen | MLLKKAHLLRWRARVLAAAYLEYASLDPSLAALHLDLFEQPAEK* |
| Ga0182021_113092581 | 3300014502 | Fen | RLLKKAHLRRWHAGALGAAYRKYASLGPARAALHLDLFEQPAE* |
| Ga0182021_113642422 | 3300014502 | Fen | CSSRLLKKAHLRRWHAWALAAAYLEYASLGPSRAALHLDLFEQPAEE* |
| Ga0182021_118327152 | 3300014502 | Fen | SDPNRLLKKAHLRRWHARALATAYLEYASRSLSRAALHLDLFE* |
| Ga0182021_131430771 | 3300014502 | Fen | RLLKKTHLRRWLARTLVAAYLEYASLGPSRAALHLDLFEQPAEK* |
| Ga0182027_102554035 | 3300014839 | Fen | AHLRRWNAQALVAAYLEYASLGLPHSALHLDLFEQPAEE* |
| Ga0182027_107592781 | 3300014839 | Fen | SRLLKKAHLRRWHAWALVAAYLEYASLGPSRAALHLDLFEQPAEE* |
| Ga0187775_101814212 | 3300017939 | Tropical Peatland | RLLKKAHLRRWPARALAAAYPEYASLGASRAALHLDLFEQPG |
| Ga0187779_107886482 | 3300017959 | Tropical Peatland | MVSRLLKKAHLRRWRARALAAAYPEYASLGASRAALHLDLFE |
| Ga0187778_102050822 | 3300017961 | Tropical Peatland | LLKKAHLRRWRARALAAAYPKYASLGASRAALHLDLFEQPAQK |
| Ga0187778_107161062 | 3300017961 | Tropical Peatland | MTPGARLLKKAHLRRWRARALPAAYPAYASVGASRAALHLDLFEQ |
| Ga0187781_108739872 | 3300017972 | Tropical Peatland | MARLSGLLKKAHLRRWCARALPAAYPAYASVGASRAALHLDLFEQ |
| Ga0187766_100194384 | 3300018058 | Tropical Peatland | MVSRLLKKAHLRRWRARALAAAYPEYASLGASRAALHLDLFEQ |
| Ga0187769_100443441 | 3300018086 | Tropical Peatland | LLKKAHLRRWRARALAAAYPEYASLGASRAALHLDLFEQPGQMP |
| Ga0256681_121998862 | 3300023311 | Freshwater | MAHLLRWLARALVAAYPVYASLDPSRAALHLDLFEQ |
| (restricted) Ga0233425_103074801 | 3300024054 | Freshwater | MTHLLRWNAQALVAAYLEYASLGLPRSALHLDLFEQPEPG |
| (restricted) Ga0233425_103753531 | 3300024054 | Freshwater | DRPPDAAPRGDVRRRLLKKVHLRRWFGSALAATYLQYASLGLRQTALHMNLFEQPE |
| Ga0124853_12003791 | 3300024056 | Freshwater Wetlands | PGLAPGLNRPLKPAHLRRWKTQALIAAYLQYASLGLPSSALHLDRFERPGPD |
| Ga0209226_102475113 | 3300025865 | Arctic Peat Soil | GGPGRLLKKAHLLRWNAQAFVAAYLEYASLSLLHSALHLDLFEQPAER |
| Ga0208665_100961313 | 3300027715 | Deep Subsurface | LKKAHLRRWPTSPLAAAYLQYASLGLRRAALQLDLFEQPERI |
| Ga0209797_100776171 | 3300027831 | Wetland Sediment | KKAHLRRWRARALVAAYLEYASLGASLAALHLVLFEQPGKKRVLR |
| Ga0209798_102726482 | 3300027843 | Wetland Sediment | DDSSADFSRPLKTAHLLRWRVRALAAAYLEYASLGPALAAWHLDRFERPDR |
| Ga0209397_103641742 | 3300027871 | Wetland | YRGRRDRRSRLLKKAHLLRWLPRALVAAYLEYASLGPAVAALHLSLFEQPGEN |
| Ga0209496_100716911 | 3300027890 | Wetland | RPASSPLKTAHLLRWLASPLAATYLQYASLGLRRAALHLDRFERPGR |
| Ga0209496_101192861 | 3300027890 | Wetland | SRLVKKAHLPRWPASALAATYFQYASLGLRRAALHLDLFEQPEERGTSAFS |
| Ga0209496_102065331 | 3300027890 | Wetland | REVSHRLLKKVHLRRWFAWSLVAACLEYASLGPSRTALHLGLFEQPE |
| Ga0209391_102685581 | 3300027975 | Freshwater Sediment | MSTATSYRLLKKAHLRRWFASALAATYLQYASLGLRQTALHLALFEPP |
| Ga0255358_10643632 | 3300028069 | Soil | PGRLLKKAHLRRWNAQALVAAYLEYASLGLPHSALHLDLFEQPE |
| Ga0302321_1002190942 | 3300031726 | Fen | MLLKKAHLLRWRARVLAAAYLEYASLKPSLAALHLDLFEQPG |
| Ga0315290_114100502 | 3300031834 | Sediment | WSFRGMNAPDRLLKKAHLPRWPASPLAAAYLQCASLGLRHAALHLDLFEQPARK |
| Ga0315283_124234281 | 3300032164 | Sediment | SGRIISRLLKKAYLRRWNAQALVAAYLQYASLGLPHSALHLDLFEQPGR |
| Ga0315268_126826032 | 3300032173 | Sediment | LASPNRLLKKAHLLRWHAWALVAAYLEYASLGPSRAALHLDLFEQPTKK |
| Ga0315276_120098152 | 3300032177 | Sediment | MPDADPVSSRLLKKAHLRRWRARAALRRTRQYASHHASRAALH |
| Ga0315271_106175291 | 3300032256 | Sediment | VAPNPGRPLKKAHLLRWNAQALVAAYLEYASLGLPHSVLHLDLFERPE |
| Ga0315275_103886021 | 3300032401 | Sediment | MRWWSGPNRLLKKAHLRRWHAGALVAAYRKYASLGPARAALHLDLFEQPGRK |
| Ga0315273_100675251 | 3300032516 | Sediment | LLKRAHLLRWHTRALAAAYLEYASLGPLRAALHLDLFEQPG |
| Ga0315273_104275661 | 3300032516 | Sediment | SRLLKKAHLLRWHAWALAAAYLEYASLSPARAALHLDFFEQPMNVSISAAC |
| Ga0315273_111237241 | 3300032516 | Sediment | WWTGRLLKKAHLLRWHARALAAAYLKYASLGPSRAALHLDLFEQPERKRVFQ |
| Ga0335085_115593291 | 3300032770 | Soil | ARLRRWRASALAAAYAEYASLGGSPAALHLDLFEQPERELRG |
| Ga0335082_112786252 | 3300032782 | Soil | VCNRLLKKAHLRRWSAPALAAAYQEYASLGGSQTALHLDLFEQPERKFSG |
| Ga0335077_112894702 | 3300033158 | Soil | RCRAFVFMRLLKTAHLLRWPASALAAAYHQYASLGLRCAALHMDRFEQPR |
| Ga0316605_107776082 | 3300033408 | Soil | LRGRLLKKAHLRRWPASALAAAYLQYASLGLRCAALHLDLFEQPP |
| Ga0316603_112818072 | 3300033413 | Soil | MTATLLKTAHLLRWSARALAAAYLEYASLGAPRSALHLDLFEQPGRDT |
| Ga0316619_101766101 | 3300033414 | Soil | RASISVRSRLLKKAHVRRWPASALAAAYLQYASLGLWRAALHLDLFEQPGR |
| Ga0316619_118467751 | 3300033414 | Soil | METPRRLLKKAHLLRWLAQALVAAYLEYASLGLTLAALHLSLFEQPG |
| Ga0316619_119099922 | 3300033414 | Soil | VTGRLLKKAHLLRWLPRALVAAYLEYASLGPAVAALHLDLFEQP |
| Ga0316622_1005089702 | 3300033416 | Soil | DRLLENAHLRRWSASPLAAAYLQYASLGLRLSALHLGLFEQRQAYGFFSIL |
| Ga0316622_1008164381 | 3300033416 | Soil | LLKKAHLLRWRARALAATYQEYASLGPSRAALHLGLFEQPGG |
| Ga0316622_1028706581 | 3300033416 | Soil | AVKKAHLRRWRACALVAAYLEYASLGASHAALHLDLFEQPGR |
| Ga0316625_1006439801 | 3300033418 | Soil | AAPAVAFGGLLKKADLRRWPASALAATYLQYASLGLRRAALHLGPF |
| Ga0316601_1000091771 | 3300033419 | Soil | LKKAHLRRWSAWALAAAYLEYASLGPSRTALHLDLFEQPEK |
| Ga0326726_110571131 | 3300033433 | Peat Soil | RQERYSPIRLLKKAHLLRCPASPLAAAYLQYASLGLRRAALHLDLFEQPG |
| Ga0326726_111669372 | 3300033433 | Peat Soil | MVVSLGRLLKKAHLQRWSPLPLAAAYFQYASLGLQRSALHLDRFEQPG |
| Ga0316627_1009246391 | 3300033482 | Soil | RLLKKAHLLRWNARALIAAYLEYASLGAPRSALHLDLFEQPG |
| Ga0316629_101835101 | 3300033483 | Soil | MKAPFSRLLKKAHLRRWSALPLAAAYFQYTSLGHRHSALHLGPFEQPGEKRGFP |
| Ga0316629_108247022 | 3300033483 | Soil | AMNRLLKKAHLRRWRAWALAAAYQEYASLGPSHAALHLDLFEQPEQ |
| Ga0316626_100432673 | 3300033485 | Soil | QAAEKAHPRRWLTPALVAAYLEYASLGPTCAALRLDLFEQPGQNPFFVI |
| Ga0316621_102112202 | 3300033488 | Soil | VKKVHLLGWMASALPATYLQYASLGLRPSALHLDLFELPA |
| Ga0316628_1010898582 | 3300033513 | Soil | MGSRLLKKAHLRRWPASALAAAYHQYASLGLWRAALHLGLF |
| Ga0316628_1024105281 | 3300033513 | Soil | MHTTSPSRLLKKAHLPRWRAQALAAAYLQYASLGLSPAALHLGLFEQPGENALFS |
| Ga0316628_1026327961 | 3300033513 | Soil | WTNRLLKKAHLRRWLASPLAAAYLQYASLGLRHAALHLDLFEQPG |
| Ga0316616_1022857211 | 3300033521 | Soil | GVTSRLLKKAHLRRWLPRALVAAYLEYASLGPAVAALRLDLFEQPGEN |
| Ga0316616_1023369501 | 3300033521 | Soil | SRLLKTVHLRRWRTSPLPAAYLQYASLGLQRAALHLDLFEQPGK |
| Ga0316616_1024829032 | 3300033521 | Soil | LLKRTHLLRWPASALAAAFLQYASLGRRPAALHLGPFVQPERK |
| Ga0314864_0151409_3_149 | 3300033805 | Peatland | MSIASSRLLKKAHLRRWRARALAATYPVYASLGPARAALHLDLFEQPAG |
| Ga0314865_093621_655_786 | 3300033806 | Peatland | LLKKAHLRRWRARALAAAYPEYASLGASRAALHLDLFEQPGQK |
| ⦗Top⦘ |