


| Basic Information | |
|---|---|
| Family ID | F087385 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VNNAGSDLLSHTVSHAVPSAVAGLTSVFGMGTGVTLLL |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.21 % |
| % of genes near scaffold ends (potentially truncated) | 26.36 % |
| % of genes from short scaffolds (< 2000 bps) | 77.27 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.455 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (6.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (32.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.15% β-sheet: 0.00% Coil/Unstructured: 84.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01569 | PAP2 | 1.82 |
| PF15919 | HicB_lk_antitox | 1.82 |
| PF00270 | DEAD | 1.82 |
| PF01791 | DeoC | 1.82 |
| PF00072 | Response_reg | 0.91 |
| PF00501 | AMP-binding | 0.91 |
| PF01979 | Amidohydro_1 | 0.91 |
| PF00534 | Glycos_transf_1 | 0.91 |
| PF13489 | Methyltransf_23 | 0.91 |
| PF00583 | Acetyltransf_1 | 0.91 |
| PF12695 | Abhydrolase_5 | 0.91 |
| PF05717 | TnpB_IS66 | 0.91 |
| PF01661 | Macro | 0.91 |
| PF08545 | ACP_syn_III | 0.91 |
| PF04434 | SWIM | 0.91 |
| PF08695 | Coa1 | 0.91 |
| PF13344 | Hydrolase_6 | 0.91 |
| PF06769 | YoeB_toxin | 0.91 |
| PF01653 | DNA_ligase_aden | 0.91 |
| PF02824 | TGS | 0.91 |
| PF02687 | FtsX | 0.91 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF00551 | Formyl_trans_N | 0.91 |
| PF14026 | DUF4242 | 0.91 |
| PF02706 | Wzz | 0.91 |
| PF13185 | GAF_2 | 0.91 |
| PF12821 | ThrE_2 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.91 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 0.91 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.91 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.91 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.45 % |
| Unclassified | root | N/A | 33.64 % |
| Niallia | genus | Niallia | 0.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2030936001|Nasutiter_Contig45313 | Not Available | 731 | Open in IMG/M |
| 2070309004|prs_FIHLEPW02RP30B | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 515 | Open in IMG/M |
| 3300005340|Ga0070689_101583731 | Not Available | 595 | Open in IMG/M |
| 3300006032|Ga0066696_10000069 | All Organisms → cellular organisms → Bacteria | 32188 | Open in IMG/M |
| 3300006059|Ga0075017_101350126 | Not Available | 560 | Open in IMG/M |
| 3300006102|Ga0075015_100414471 | Not Available | 762 | Open in IMG/M |
| 3300006224|Ga0079037_102200908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 551 | Open in IMG/M |
| 3300006640|Ga0075527_10037281 | Not Available | 1303 | Open in IMG/M |
| 3300006838|Ga0101938_1001102 | All Organisms → cellular organisms → Bacteria | 7446 | Open in IMG/M |
| 3300006852|Ga0075433_10723131 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300006931|Ga0097620_101769308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 683 | Open in IMG/M |
| 3300009083|Ga0105047_10049862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 5806 | Open in IMG/M |
| 3300009088|Ga0099830_10129451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Pelagibius → Pelagibius marinus | 1920 | Open in IMG/M |
| 3300009088|Ga0099830_11245950 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300009091|Ga0102851_10709515 | Not Available | 1065 | Open in IMG/M |
| 3300009098|Ga0105245_10974702 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009101|Ga0105247_11516383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 547 | Open in IMG/M |
| 3300009137|Ga0066709_102413708 | Not Available | 714 | Open in IMG/M |
| 3300009143|Ga0099792_10546481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 731 | Open in IMG/M |
| 3300009177|Ga0105248_12425563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → environmental samples → uncultured Acidobacteriales bacterium HF0200_23L05 | 598 | Open in IMG/M |
| 3300009448|Ga0114940_10056960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1747 | Open in IMG/M |
| 3300009518|Ga0116128_1068819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
| 3300009610|Ga0105340_1121816 | Not Available | 1060 | Open in IMG/M |
| 3300009616|Ga0116111_1003077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9476 | Open in IMG/M |
| 3300009683|Ga0116224_10413620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 642 | Open in IMG/M |
| 3300009772|Ga0116162_10009581 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 5329 | Open in IMG/M |
| 3300009839|Ga0116223_10063675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2376 | Open in IMG/M |
| 3300009839|Ga0116223_10475495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 729 | Open in IMG/M |
| 3300009943|Ga0117933_1535913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 564 | Open in IMG/M |
| 3300010037|Ga0126304_11073661 | Not Available | 550 | Open in IMG/M |
| 3300010042|Ga0126314_11158849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 577 | Open in IMG/M |
| 3300010044|Ga0126310_10488960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → environmental samples → uncultured Desulfobacterales bacterium HF0200_07G10 | 897 | Open in IMG/M |
| 3300010046|Ga0126384_10103983 | Not Available | 2102 | Open in IMG/M |
| 3300010373|Ga0134128_12325009 | Not Available | 590 | Open in IMG/M |
| 3300010399|Ga0134127_10824580 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300011119|Ga0105246_12031470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → environmental samples → uncultured Acidobacteriales bacterium HF0200_23L05 | 555 | Open in IMG/M |
| 3300012001|Ga0120167_1114384 | Not Available | 544 | Open in IMG/M |
| 3300012360|Ga0137375_10404465 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 70 | 1192 | Open in IMG/M |
| 3300012505|Ga0157339_1063858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 517 | Open in IMG/M |
| 3300012906|Ga0157295_10214022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → environmental samples → uncultured Acidobacteriales bacterium HF0200_23L05 | 623 | Open in IMG/M |
| 3300012907|Ga0157283_10119512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300012925|Ga0137419_10119262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1859 | Open in IMG/M |
| 3300012929|Ga0137404_11241111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 686 | Open in IMG/M |
| 3300012964|Ga0153916_10824618 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10150426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1411 | Open in IMG/M |
| 3300013362|Ga0121694_110032 | Niallia → Niallia circulans | 569 | Open in IMG/M |
| 3300014161|Ga0181529_10078402 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300014745|Ga0157377_11092242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 610 | Open in IMG/M |
| 3300014839|Ga0182027_10139270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2871 | Open in IMG/M |
| 3300014969|Ga0157376_10664185 | Not Available | 1044 | Open in IMG/M |
| 3300015171|Ga0167648_1106730 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300018019|Ga0187874_10000322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 61402 | Open in IMG/M |
| 3300018059|Ga0184615_10033426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2847 | Open in IMG/M |
| 3300018067|Ga0184611_1243454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 637 | Open in IMG/M |
| 3300018432|Ga0190275_10679039 | Not Available | 1085 | Open in IMG/M |
| 3300019880|Ga0193712_1099499 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira biflexa → Leptospira biflexa serovar Patoc → Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' | 627 | Open in IMG/M |
| 3300020021|Ga0193726_1000218 | All Organisms → cellular organisms → Bacteria | 78216 | Open in IMG/M |
| 3300020579|Ga0210407_10034070 | All Organisms → cellular organisms → Bacteria | 3788 | Open in IMG/M |
| 3300021171|Ga0210405_10047630 | Not Available | 3397 | Open in IMG/M |
| 3300021445|Ga0182009_10229478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 914 | Open in IMG/M |
| 3300021559|Ga0210409_11592581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300022524|Ga0224534_1072105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300022917|Ga0247777_1056880 | Not Available | 1372 | Open in IMG/M |
| 3300023251|Ga0222683_1002301 | All Organisms → cellular organisms → Bacteria | 4568 | Open in IMG/M |
| 3300023263|Ga0247800_1080098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → environmental samples → uncultured Acidobacteriales bacterium HF0200_23L05 | 638 | Open in IMG/M |
| 3300025469|Ga0208687_1031266 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300025563|Ga0210112_1013423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1806 | Open in IMG/M |
| 3300026035|Ga0207703_11585236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 630 | Open in IMG/M |
| 3300026035|Ga0207703_11642349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 618 | Open in IMG/M |
| 3300026088|Ga0207641_11322116 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300026180|Ga0209938_1022242 | Not Available | 2166 | Open in IMG/M |
| 3300026216|Ga0209903_1026369 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 59 | 924 | Open in IMG/M |
| 3300026291|Ga0209890_10164476 | Not Available | 730 | Open in IMG/M |
| 3300026323|Ga0209472_1191242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 715 | Open in IMG/M |
| 3300026551|Ga0209648_10646642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → environmental samples → uncultured Acidobacteriales bacterium HF0200_23L05 | 579 | Open in IMG/M |
| 3300027583|Ga0209527_1040052 | Not Available | 1054 | Open in IMG/M |
| 3300027690|Ga0209164_1000001 | All Organisms → cellular organisms → Bacteria | 1121355 | Open in IMG/M |
| 3300027867|Ga0209167_10354326 | Not Available | 798 | Open in IMG/M |
| 3300027884|Ga0209275_10206072 | Not Available | 1065 | Open in IMG/M |
| 3300027907|Ga0207428_10138667 | Not Available | 1858 | Open in IMG/M |
| 3300028173|Ga0257118_1065910 | Not Available | 865 | Open in IMG/M |
| 3300028380|Ga0268265_11479087 | Not Available | 682 | Open in IMG/M |
| 3300028381|Ga0268264_10014996 | All Organisms → cellular organisms → Bacteria | 6360 | Open in IMG/M |
| 3300028717|Ga0307298_10058804 | Not Available | 1060 | Open in IMG/M |
| 3300029939|Ga0311328_10327146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1125 | Open in IMG/M |
| 3300029987|Ga0311334_10856264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 750 | Open in IMG/M |
| 3300029990|Ga0311336_10423951 | Not Available | 1118 | Open in IMG/M |
| 3300030496|Ga0268240_10073336 | Not Available | 769 | Open in IMG/M |
| 3300030518|Ga0302275_10050493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3116 | Open in IMG/M |
| 3300030618|Ga0311354_10094997 | All Organisms → cellular organisms → Bacteria | 3340 | Open in IMG/M |
| 3300031281|Ga0307420_1082016 | Not Available | 1117 | Open in IMG/M |
| 3300031660|Ga0307994_1000067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Rossellomorea → Rossellomorea aquimaris | 86583 | Open in IMG/M |
| 3300031824|Ga0307413_11141755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300031854|Ga0310904_11269084 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031943|Ga0310885_10323834 | Not Available | 802 | Open in IMG/M |
| 3300031995|Ga0307409_102573515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 537 | Open in IMG/M |
| 3300032002|Ga0307416_103211522 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032144|Ga0315910_10725211 | Not Available | 772 | Open in IMG/M |
| 3300032174|Ga0307470_11823453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 515 | Open in IMG/M |
| 3300032179|Ga0310889_10405503 | Not Available | 677 | Open in IMG/M |
| 3300032180|Ga0307471_103708181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 540 | Open in IMG/M |
| 3300032420|Ga0335397_10071313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 3698 | Open in IMG/M |
| 3300032456|Ga0335394_10120394 | All Organisms → cellular organisms → Bacteria | 2679 | Open in IMG/M |
| 3300032892|Ga0335081_10748911 | Not Available | 1176 | Open in IMG/M |
| 3300033405|Ga0326727_10970490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → marine Actinobacteria clade → environmental samples → uncultured actinobacterium HF0130_15N16 | 625 | Open in IMG/M |
| 3300033433|Ga0326726_10049020 | Not Available | 3694 | Open in IMG/M |
| 3300033482|Ga0316627_101040731 | Not Available | 797 | Open in IMG/M |
| 3300033485|Ga0316626_11440982 | Not Available | 619 | Open in IMG/M |
| 3300033513|Ga0316628_102265037 | Not Available | 719 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.73% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.73% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.82% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.82% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.82% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.91% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.91% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.91% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.91% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment | 0.91% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.91% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
| Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.91% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.91% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
| Termite Hindgut | Host-Associated → Arthropoda → Digestive System → Hindgut → P3 Segment → Termite Hindgut | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.91% |
| Activated Sludge | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge | 0.91% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.91% |
| City Subway Metal/Plastic | Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Host-Associated | Open in IMG/M |
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006838 | Combined Assembly of Gp0125106, Gp0125107, Gp0125108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009448 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG | Engineered | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300009943 | Combined Assembly of Gp0139325, Gp0139347, Gp0139348 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013362 | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P01505 | Engineered | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014830 | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M92511 | Engineered | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022917 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5 | Environmental | Open in IMG/M |
| 3300023251 | Saline water microbial communities from Ace Lake, Antarctica - #1073 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025563 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026180 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_C_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027690 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028173 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_150m | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031281 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-40 | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Nasutiterm_492870 | 2030936001 | Termite Hindgut | FRQKKPGSYLLSRPSGGRVPSAQEGLTSVFEMGTGVTPPQ |
| prs_05014970 | 2070309004 | Green-Waste Compost | QPARFNPGNDLLSHIVTNAVPSALEGLTSVFGMGTGVTPPV*SPR |
| Ga0070689_1015837312 | 3300005340 | Switchgrass Rhizosphere | GSDLLSHAVSRGVPSALVGLTSVFGMGTGVTPPLEGPRRPF* |
| Ga0066696_100000693 | 3300006032 | Soil | LAFNSAGDDLLSHTVSRAVQSARRGLTAVFGMGTGVTPAV* |
| Ga0075017_1013501263 | 3300006059 | Watersheds | VGLQNPGSVLLSHKVAPAVPSALESLTSVFGMGTGVTSPV* |
| Ga0075015_1004144712 | 3300006102 | Watersheds | LFFEIYPGGDLRSHTVTRAVSSAQRGLTTVFGMGTGVTPAM* |
| Ga0079037_1022009082 | 3300006224 | Freshwater Wetlands | VSLQNPGSVLLSHRVAPTVPLALESLTSVFGMGTGVTSPV* |
| Ga0075527_100372811 | 3300006640 | Arctic Peat Soil | CRGDSVGDLLSHRVASAVPLAVAGLTSVFGMGTGVALLL* |
| Ga0101938_100110210 | 3300006838 | Sediment | LILPGGVLLSQKVTLLVPSALEVLTSVFGMGTGVAPPL* |
| Ga0075433_107231312 | 3300006852 | Populus Rhizosphere | VRINPGDFLLSHAVSRAVPSAPAGLTSVFGMGTGVTLPTKSP |
| Ga0097620_1017693083 | 3300006931 | Switchgrass Rhizosphere | LFFSNTPGSDLLSHRVSPTVPSAVSGLTSVFGMGTGVTLIL* |
| Ga0105047_100498622 | 3300009083 | Freshwater | LVSKSGGDLLSQGVYPQVPSAQAVLTSVFGMGTGVTLPL* |
| Ga0099830_101294512 | 3300009088 | Vadose Zone Soil | MGLLYYAGDHLISHTLTRAVPSAQRGLTSVFGMGTGVTLAV |
| Ga0099830_112459502 | 3300009088 | Vadose Zone Soil | VFYPGGDLRSHTVTRAVSSALRGLTTVFGMGTGVTPAV |
| Ga0102851_107095153 | 3300009091 | Freshwater Wetlands | VDTPGSDLLSHRVAPAVPSAVEGLTSVFGMGTGVAPLL* |
| Ga0105245_109747021 | 3300009098 | Miscanthus Rhizosphere | LLNNPGDFLLSHAVSRAVPSAPAGLTSVFGMGTGVTL |
| Ga0105247_115163833 | 3300009101 | Switchgrass Rhizosphere | LRNNAGSDLLSHTVSHAVPSAVAGLTSVFGMGTGVSLLL* |
| Ga0066709_1024137083 | 3300009137 | Grasslands Soil | VRNKPGDFLLSHTLARAVPSGLRGLTTVFGMGTGGSLSL* |
| Ga0099792_105464813 | 3300009143 | Vadose Zone Soil | VNNAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL* |
| Ga0105248_124255633 | 3300009177 | Switchgrass Rhizosphere | LINNPGGDLLSHAVTHTVPSAVAGLTSVFGMGTGVTLLL* |
| Ga0114940_100569602 | 3300009448 | Groundwater | LISKSGGDLLSQGVYPQVPSAQAVLTSVFGMGTGVTLPL* |
| Ga0116128_10688193 | 3300009518 | Peatland | NPGDDRLSYPDQIGTVPWALEGLTSVFGMGTGVSAPL* |
| Ga0105340_11218163 | 3300009610 | Soil | LFNTPGSDLLSHAVSHTVPSTVAGLTSVFGMGTGVALLL* |
| Ga0116111_10030773 | 3300009616 | Peatland | LFEMNSGDDLLSQGVSPQVPSAQAGLTSVFGMGTGVTLPL* |
| Ga0116224_104136202 | 3300009683 | Peatlands Soil | VAFIYAGNDLLSHTVSRAVQSALRGLTSVFGMGTGVSPAVI |
| Ga0116162_100095814 | 3300009772 | Anaerobic Digestor Sludge | MYYFKPGSVLLSHTVTHAVPSAMRSLTSVFGMGTGVASSL* |
| Ga0116223_100636751 | 3300009839 | Peatlands Soil | VAFIYAGNDLLSHTVSRAVQSALRGLTSVFGMGTGVSP |
| Ga0116223_104754952 | 3300009839 | Peatlands Soil | LSEMNSGDDLLSQGVSPQVPSAQAGLTSVFGMGTGVT |
| Ga0117933_15359132 | 3300009943 | Hot Spring Fe-Si Sediment | LEKTPGSDLLSHAAARAVPSAVEGLTSVLGMGTGVTLPLWP |
| Ga0126304_110736613 | 3300010037 | Serpentine Soil | VSLQNPGSVLLSHRVAPAIPSALKSLTSVFGMGTGVTSPV* |
| Ga0126314_111588493 | 3300010042 | Serpentine Soil | LNNAGSDLLSHTVSRAVPSAVVGLTSVFGKGTGVTLLL* |
| Ga0126310_104889603 | 3300010044 | Serpentine Soil | LAMFNSGSDLLSHTVAHAVPSAPKDLTSVFGMGTGVTPSI* |
| Ga0126384_101039833 | 3300010046 | Tropical Forest Soil | VGLQNPGSVLLSHRVAPAVPSALKSLTSVFGMGTGVTSSV* |
| Ga0134128_123250092 | 3300010373 | Terrestrial Soil | LLKNNAGDHLISHTLSRAVPSAQRGLTSVFGMGTGGTLAV |
| Ga0134127_108245802 | 3300010399 | Terrestrial Soil | VRNNPGDFLLSHAVSRAVPSAPAGLTSVFGMGTGVTLPTKSP |
| Ga0105246_120314703 | 3300011119 | Miscanthus Rhizosphere | LRNNAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL* |
| Ga0120167_11143842 | 3300012001 | Permafrost | VNYAGDHLISHTLTRAVPSAQRGLTSVFGMGTGGT |
| Ga0137375_104044652 | 3300012360 | Vadose Zone Soil | LKNNAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL* |
| Ga0157339_10638582 | 3300012505 | Arabidopsis Rhizosphere | LRITAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL* |
| Ga0157295_102140223 | 3300012906 | Soil | MNNPGSDLLSHAVSHAVPSAVESLTSVFGMGTGVTSLL* |
| Ga0157283_101195123 | 3300012907 | Soil | MSNPGDDLLFHVVAHEVPSALKGLTSVFGMGTGVTLLL* |
| Ga0137419_101192622 | 3300012925 | Vadose Zone Soil | LFNPGNYLVSHKVALAVPSAQRGLTSVFGMGTGVALSVR |
| Ga0137404_112411113 | 3300012929 | Vadose Zone Soil | MNYPGGVLLSHAVARAVSLAMRSLTAVFGMGTGVTSAL* |
| Ga0153916_108246183 | 3300012964 | Freshwater Wetlands | MGSKNIPGDDLLSHDLTIIVSSALESLTSVFGMGTGVTPPV* |
| (restricted) Ga0172369_101504263 | 3300013125 | Freshwater | LNPGDDLLSHAVTHAVPSALEGLTSVFGMGTGVTPPL* |
| Ga0121694_1100321 | 3300013362 | City Subway Metal/Plastic | VPGDVLLSQGENPQLPSALRSLTSVFGMGTGVTFSL |
| Ga0181529_100784021 | 3300014161 | Bog | MGLLDYAGDHLISHTLTRAVPSAQRSLTSVFGMGTGVTFV |
| Ga0157377_110922423 | 3300014745 | Miscanthus Rhizosphere | LRNNAGSDLLSHTVSHTVPSAVSGLTSVFGMGTGVTLIL* |
| Ga0119906_10885133 | 3300014830 | Activated Sludge | LSAKSGGVLLSQGVYPQVPSALAVLTSVFGMGTGVTLPL* |
| Ga0182027_101392702 | 3300014839 | Fen | LSENNSGDDLLSQGVSPQVPSAQAGLTSVFGMGTGVTLPL |
| Ga0157376_106641853 | 3300014969 | Miscanthus Rhizosphere | VAFRKNPGSDLLSHTVTHAVPSAVAGLTSVFGMGTGVTLLL* |
| Ga0167648_11067303 | 3300015171 | Glacier Forefield Soil | VLEKSGGVLLSQGVYPQVPLALAVLTSVFGMGTGVTLPL* |
| Ga0187874_100003223 | 3300018019 | Peatland | LFEMNSGDDLLSQGVSPQVPSAQAGLTSVFGMGTGVTLPL |
| Ga0184615_100334263 | 3300018059 | Groundwater Sediment | LFIIPGGDLLSHTATRAVSSALRGLTSVFGMGTGVTPSA |
| Ga0184611_12434543 | 3300018067 | Groundwater Sediment | MNNPGSDLLSHTPTHAVPSAVAGLTSVFGMGTGVTLPL |
| Ga0190275_106790393 | 3300018432 | Soil | MSPQNPGSVLLSHRVAPAVPSALESLTSVFGMGTGVTSPV |
| Ga0193712_10994993 | 3300019880 | Soil | VGLQNPGSVLLSHRVAPAVPSALKSLTSVFGMGTGVTSSV |
| Ga0193726_10002183 | 3300020021 | Soil | LNFNPGDDLRSHTVARAVSSAQRGLTSVFGMGTGVTLAV |
| Ga0210407_100340702 | 3300020579 | Soil | LFFELYPGGDLRSHTVTRAVSSAQRGLTTVFGMGTGVTPAM |
| Ga0210405_100476304 | 3300021171 | Soil | MTAGSDLLSHTVSHAVPSAVAGLTSVFGMGTGVTLLL |
| Ga0182009_102294783 | 3300021445 | Soil | LLKNTPGSDLLSHTPTRAVPSAVAGLTTVFGMGTGGTLPL |
| Ga0210409_115925812 | 3300021559 | Soil | LKFNPGGDLRSRAVTRAVSSAQQGLTSVFGMGTGVTL |
| Ga0224534_10721052 | 3300022524 | Soil | LSQMNSGDDLLSQGVSPQVPSAQAGLTSVFGMGTGVTLPL |
| Ga0247777_10568803 | 3300022917 | Plant Litter | VSLQNPGSVLLSHRVAPAVPLALKSLTSVFGMGTGVTSSE |
| Ga0222683_10023016 | 3300023251 | Saline Water | VTVYKDGGDLLCHSVAGTVPSARVSLTSVFGMGTGVTLPL |
| Ga0247800_10800983 | 3300023263 | Soil | VNNAGSDLLSHTVSHAVPSAVAGLTSVFGMGTGVTLLL |
| Ga0208687_10312663 | 3300025469 | Peatland | VSEMNSGDDLLSQGVSPQVPSAQASLTSVFGMGTGVTLPL |
| Ga0210112_10134233 | 3300025563 | Natural And Restored Wetlands | MGRGGGDLLSHAIARAVPSALRSLTTVFGMGTGVTSSL |
| Ga0207703_115852363 | 3300026035 | Switchgrass Rhizosphere | LRNNAGSDLLSHTVSHAVPSAVAGLTSVFGMGTGVSLLL |
| Ga0207703_116423493 | 3300026035 | Switchgrass Rhizosphere | LRNNAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL |
| Ga0207641_113221162 | 3300026088 | Switchgrass Rhizosphere | VQINPGDFLLSHAVSRAVPSAPAGLTSVFGMGTGVTL |
| Ga0209938_10222422 | 3300026180 | Pond Soil | LKTGNGLLSHTAARAVPSAQESLTAVFGMGTGVTSLPL |
| Ga0209903_10263692 | 3300026216 | Soil | LIKNAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL |
| Ga0209890_101644763 | 3300026291 | Soil | LNINPGDDLRSHTVARAVSSARRGLTSVFGMGTGVTLAV |
| Ga0209472_11912423 | 3300026323 | Soil | MTAGSDLLSHTVSHAVPSAESGLTSVFGMGTGVTLIL |
| Ga0209648_106466423 | 3300026551 | Grasslands Soil | LVENNPGSDLLSHAVAHAVPSAVASLTSVFGMGTGVTLLL |
| Ga0209527_10400523 | 3300027583 | Forest Soil | LRNNAGSDLLSHTVSHAVPSAVASLTSVFGMGTGVTLLL |
| Ga0209164_1000001281 | 3300027690 | Enrichment Culture | MYDANPGSVLLSHTVTRAVPSAMRDLTSVFGMGTGVALSL |
| Ga0209167_103543262 | 3300027867 | Surface Soil | VAFINAGNDLLSHTLSRAVQSARRGLTSVFGMGTGGSPAV |
| Ga0209275_102060723 | 3300027884 | Soil | LNNAGSDLLSHTVSHAVPSAVAGLTSVFGMGTGVTLLL |
| Ga0207428_101386673 | 3300027907 | Populus Rhizosphere | VALEKNPGTVLLSHRVSPAVPSALEDFTSVFGMGTGVTPPA |
| Ga0257118_10659103 | 3300028173 | Marine | LRKTWISGSVLLSHTVSHAVPSALKDFTAVFDMGTGVAPSL |
| Ga0268265_114790873 | 3300028380 | Switchgrass Rhizosphere | LSFSNTPGSDLLSHRVSPTVPSAVSGLTSVFGMGTGVTLIL |
| Ga0268264_100149962 | 3300028381 | Switchgrass Rhizosphere | VNNPGDFLLSHAVSRAVPSAPTGLTSVFGMGTGVTL |
| Ga0307298_100588043 | 3300028717 | Soil | LRINAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL |
| Ga0311328_103271461 | 3300029939 | Bog | LYEMNSGDDLLSQGVSPQVPSAQAGLTSVFGMGTGV |
| Ga0311334_108562642 | 3300029987 | Fen | VGLQNPGSVLLSHKVAPAVPSALESLTSVFGMGTGVTSPV |
| Ga0311336_104239513 | 3300029990 | Fen | VFEKSGGVLLSQGVYPQVPSALAVLTSVFGMGTGVTLPL |
| Ga0268240_100733363 | 3300030496 | Soil | VITAGSDLLSHTVSHAVPSAVAGLTSVFGMGTGVTLLL |
| Ga0302275_100504931 | 3300030518 | Bog | MGLLNYAGDHLISHTLTRAVPSAQRGLTSVFGMGTGV |
| Ga0311354_100949972 | 3300030618 | Palsa | LLTNYAGDHLISHTLTRAVPSAQRGLTSVFGMGTG |
| Ga0307420_10820163 | 3300031281 | Salt Marsh | MIGCDLLFHTVSHAVPSAHVCLTSVFGMGTGVTTLL |
| Ga0307994_10000672 | 3300031660 | Marine | LPGDVLLSQGEIPQLPSALKSLTSVFGMGTGVTSSPLSP |
| Ga0307413_111417551 | 3300031824 | Rhizosphere | VQINPGSDLLSHTPAHAVPSAVAGLTSVFGMGTGVTLPL |
| Ga0310904_112690843 | 3300031854 | Soil | LVNNAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGGTLIL |
| Ga0310885_103238343 | 3300031943 | Soil | LVDVNNPGSDLLSHAVAHAVPSAVASLTSVFGMGTGVTLLL |
| Ga0307409_1025735152 | 3300031995 | Rhizosphere | LENTPGSDLLSHALTHAVPSAVEGLTSVFGMGTGVTPLL |
| Ga0307416_1032115223 | 3300032002 | Rhizosphere | LDNIPGSDLLSHRPAPAVPSAVEGLTSVFGMGTGVTLLL |
| Ga0315910_107252113 | 3300032144 | Soil | LRIIPGSDLLSHKAALAVPSAVEGLTSVFGMGTGVTLLL |
| Ga0307470_118234533 | 3300032174 | Hardwood Forest Soil | VCLTAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL |
| Ga0310889_104055033 | 3300032179 | Soil | LFFSNTPGSDLLSHRVSPTVPSAVSGLTSVFGMGTGVTLIL |
| Ga0307471_1037081813 | 3300032180 | Hardwood Forest Soil | MNNAGSDLLSHTVSHAVPSAVSGLTSVFGMGTGVTLIL |
| Ga0335397_100713133 | 3300032420 | Freshwater | LNSKSGGDLLSQGVYPQVPSAQAVLTSVFGMGTGVTLPL |
| Ga0335394_101203943 | 3300032456 | Freshwater | LISKSGGDLLSQGVYPQVPSAQAVLTSVFGMGTGVTLPL |
| Ga0335081_107489111 | 3300032892 | Soil | CFRSVAFIYAGDDLRSHTLSRAVPSALRGLTSVFGMGTGV |
| Ga0326727_109704902 | 3300033405 | Peat Soil | LSEMNSGDVLLSQGVSPQVPSAQAGLTSVFGMGTGVTLSL |
| Ga0326726_100490203 | 3300033433 | Peat Soil | VLEKSGGVLLSQGVYPQVPSALAVLTSVFGMGTGVTLPL |
| Ga0316627_1010407313 | 3300033482 | Soil | VSLQNPGIVLLSHRVAPAVPLALESLTSVFGMGTGVTSPV |
| Ga0316626_114409823 | 3300033485 | Soil | LKTKKIPGNDLLSHPHPGAVPSALEGLTSVFGMGTGVTPPP |
| Ga0316628_1022650373 | 3300033513 | Soil | LFHLNPGGDLLSHTAARAVPSALKGLTSVFEMGTGVTPSA |
| ⦗Top⦘ |