


| Basic Information | |
|---|---|
| Family ID | F087329 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.55 % |
| % of genes near scaffold ends (potentially truncated) | 31.82 % |
| % of genes from short scaffolds (< 2000 bps) | 76.36 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (32.727 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (36.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 79.07% β-sheet: 0.00% Coil/Unstructured: 20.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 15.45 |
| PF16778 | Phage_tail_APC | 6.36 |
| PF13759 | 2OG-FeII_Oxy_5 | 5.45 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.73 |
| PF13661 | 2OG-FeII_Oxy_4 | 1.82 |
| PF01753 | zf-MYND | 0.91 |
| PF07484 | Collar | 0.91 |
| PF02780 | Transketolase_C | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.64 % |
| Unclassified | root | N/A | 32.73 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 3.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559017|JCVI_READ_724621 | Not Available | 985 | Open in IMG/M |
| 3300001964|GOS2234_1014039 | Not Available | 1860 | Open in IMG/M |
| 3300001972|GOS2216_10084867 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1894 | Open in IMG/M |
| 3300002242|KVWGV2_10394226 | Not Available | 705 | Open in IMG/M |
| 3300002482|JGI25127J35165_1041105 | Not Available | 1028 | Open in IMG/M |
| 3300002488|JGI25128J35275_1118901 | Not Available | 527 | Open in IMG/M |
| 3300004831|Ga0069134_166844 | All Organisms → Viruses | 1430 | Open in IMG/M |
| 3300005074|Ga0070431_1168302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 796 | Open in IMG/M |
| 3300006305|Ga0068468_1040690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 966 | Open in IMG/M |
| 3300006334|Ga0099675_1526494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 793 | Open in IMG/M |
| 3300006345|Ga0099693_1627812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 539 | Open in IMG/M |
| 3300006735|Ga0098038_1005513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 5150 | Open in IMG/M |
| 3300009593|Ga0115011_10269895 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 1283 | Open in IMG/M |
| 3300009703|Ga0114933_10667785 | All Organisms → Viruses | 667 | Open in IMG/M |
| 3300011013|Ga0114934_10223370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group | 866 | Open in IMG/M |
| 3300012919|Ga0160422_10016347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 4329 | Open in IMG/M |
| 3300012919|Ga0160422_10033101 | All Organisms → Viruses → Predicted Viral | 2993 | Open in IMG/M |
| 3300012919|Ga0160422_10040956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 2685 | Open in IMG/M |
| 3300012919|Ga0160422_10057645 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2262 | Open in IMG/M |
| 3300012919|Ga0160422_10769549 | Not Available | 617 | Open in IMG/M |
| 3300012919|Ga0160422_11160895 | All Organisms → Viruses | 502 | Open in IMG/M |
| 3300012920|Ga0160423_10001929 | Not Available | 17348 | Open in IMG/M |
| 3300012920|Ga0160423_10017142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5483 | Open in IMG/M |
| 3300012920|Ga0160423_10493637 | All Organisms → Viruses | 833 | Open in IMG/M |
| 3300012920|Ga0160423_10538269 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 793 | Open in IMG/M |
| 3300012920|Ga0160423_11206660 | All Organisms → Viruses | 505 | Open in IMG/M |
| 3300012952|Ga0163180_10179621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1430 | Open in IMG/M |
| 3300012953|Ga0163179_10295022 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1280 | Open in IMG/M |
| 3300012953|Ga0163179_10635189 | Not Available | 899 | Open in IMG/M |
| 3300012953|Ga0163179_10785020 | Not Available | 815 | Open in IMG/M |
| 3300017726|Ga0181381_1013899 | All Organisms → Viruses | 1867 | Open in IMG/M |
| 3300017731|Ga0181416_1131246 | Not Available | 602 | Open in IMG/M |
| 3300017732|Ga0181415_1027798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group | 1308 | Open in IMG/M |
| 3300017733|Ga0181426_1059625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 757 | Open in IMG/M |
| 3300017733|Ga0181426_1070011 | unclassified Hyphomonas → Hyphomonas sp. | 698 | Open in IMG/M |
| 3300017738|Ga0181428_1028038 | All Organisms → Viruses | 1304 | Open in IMG/M |
| 3300017738|Ga0181428_1084299 | unclassified Hyphomonas → Hyphomonas sp. | 742 | Open in IMG/M |
| 3300017738|Ga0181428_1131342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 587 | Open in IMG/M |
| 3300017739|Ga0181433_1068895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 882 | Open in IMG/M |
| 3300017739|Ga0181433_1164991 | Not Available | 517 | Open in IMG/M |
| 3300017744|Ga0181397_1136827 | All Organisms → Viruses | 631 | Open in IMG/M |
| 3300017755|Ga0181411_1104074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group | 837 | Open in IMG/M |
| 3300017755|Ga0181411_1215351 | All Organisms → Viruses | 536 | Open in IMG/M |
| 3300017756|Ga0181382_1181473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 537 | Open in IMG/M |
| 3300017758|Ga0181409_1044195 | Not Available | 1384 | Open in IMG/M |
| 3300017759|Ga0181414_1188012 | Not Available | 535 | Open in IMG/M |
| 3300017760|Ga0181408_1049045 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1131 | Open in IMG/M |
| 3300017760|Ga0181408_1092279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 791 | Open in IMG/M |
| 3300017764|Ga0181385_1055416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1231 | Open in IMG/M |
| 3300017765|Ga0181413_1037472 | Not Available | 1515 | Open in IMG/M |
| 3300017765|Ga0181413_1255793 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 515 | Open in IMG/M |
| 3300017767|Ga0181406_1170338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 651 | Open in IMG/M |
| 3300017768|Ga0187220_1038783 | All Organisms → Viruses | 1436 | Open in IMG/M |
| 3300017769|Ga0187221_1079485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group | 1019 | Open in IMG/M |
| 3300017769|Ga0187221_1140700 | Not Available | 718 | Open in IMG/M |
| 3300017772|Ga0181430_1200913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group | 569 | Open in IMG/M |
| 3300017773|Ga0181386_1056310 | Not Available | 1258 | Open in IMG/M |
| 3300017773|Ga0181386_1114194 | Not Available | 837 | Open in IMG/M |
| 3300017786|Ga0181424_10179763 | All Organisms → Viruses | 901 | Open in IMG/M |
| 3300020246|Ga0211707_1003267 | All Organisms → Viruses | 2574 | Open in IMG/M |
| 3300020246|Ga0211707_1008703 | Not Available | 1501 | Open in IMG/M |
| 3300020246|Ga0211707_1015001 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1104 | Open in IMG/M |
| 3300020281|Ga0211483_10186485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 689 | Open in IMG/M |
| 3300020281|Ga0211483_10320609 | Not Available | 513 | Open in IMG/M |
| 3300020312|Ga0211542_1070756 | Not Available | 621 | Open in IMG/M |
| 3300020393|Ga0211618_10067622 | All Organisms → Viruses | 1329 | Open in IMG/M |
| 3300020394|Ga0211497_10067465 | Not Available | 1506 | Open in IMG/M |
| 3300020409|Ga0211472_10403843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 551 | Open in IMG/M |
| 3300020411|Ga0211587_10417132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300020413|Ga0211516_10147666 | Not Available | 1099 | Open in IMG/M |
| 3300020420|Ga0211580_10012055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3856 | Open in IMG/M |
| 3300020420|Ga0211580_10069957 | unclassified Hyphomonas → Hyphomonas sp. | 1481 | Open in IMG/M |
| 3300020422|Ga0211702_10243084 | Not Available | 556 | Open in IMG/M |
| 3300020433|Ga0211565_10009914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 4053 | Open in IMG/M |
| 3300020433|Ga0211565_10043637 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1907 | Open in IMG/M |
| 3300020436|Ga0211708_10007390 | All Organisms → Viruses | 4103 | Open in IMG/M |
| 3300020436|Ga0211708_10013899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 3029 | Open in IMG/M |
| 3300020436|Ga0211708_10016217 | All Organisms → Viruses → Predicted Viral | 2804 | Open in IMG/M |
| 3300020436|Ga0211708_10026571 | All Organisms → Viruses → Predicted Viral | 2201 | Open in IMG/M |
| 3300020436|Ga0211708_10043319 | All Organisms → Viruses | 1729 | Open in IMG/M |
| 3300020436|Ga0211708_10104226 | unclassified Hyphomonas → Hyphomonas sp. | 1111 | Open in IMG/M |
| 3300020437|Ga0211539_10008582 | Not Available | 4082 | Open in IMG/M |
| 3300020438|Ga0211576_10681300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300020451|Ga0211473_10015612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3689 | Open in IMG/M |
| 3300020451|Ga0211473_10282866 | Not Available | 852 | Open in IMG/M |
| 3300020451|Ga0211473_10464748 | Not Available | 646 | Open in IMG/M |
| 3300020451|Ga0211473_10626359 | Not Available | 543 | Open in IMG/M |
| 3300020463|Ga0211676_10478828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 663 | Open in IMG/M |
| 3300020463|Ga0211676_10480765 | Not Available | 661 | Open in IMG/M |
| 3300020469|Ga0211577_10047206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3162 | Open in IMG/M |
| 3300020469|Ga0211577_10338700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage MED4-117 | 943 | Open in IMG/M |
| 3300022074|Ga0224906_1005089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group | 5562 | Open in IMG/M |
| 3300022074|Ga0224906_1010078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 3681 | Open in IMG/M |
| 3300022074|Ga0224906_1174167 | Not Available | 597 | Open in IMG/M |
| 3300022074|Ga0224906_1189636 | All Organisms → Viruses | 564 | Open in IMG/M |
| 3300025086|Ga0208157_1002146 | Not Available | 8382 | Open in IMG/M |
| 3300025127|Ga0209348_1023844 | Not Available | 2258 | Open in IMG/M |
| 3300025132|Ga0209232_1065825 | Not Available | 1286 | Open in IMG/M |
| 3300025151|Ga0209645_1113551 | Not Available | 866 | Open in IMG/M |
| 3300025151|Ga0209645_1144417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 738 | Open in IMG/M |
| 3300027906|Ga0209404_10685583 | Not Available | 690 | Open in IMG/M |
| 3300029318|Ga0185543_1000105 | Not Available | 25009 | Open in IMG/M |
| 3300029319|Ga0183748_1001855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12128 | Open in IMG/M |
| 3300029319|Ga0183748_1003762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7767 | Open in IMG/M |
| 3300029319|Ga0183748_1017562 | All Organisms → Viruses | 2644 | Open in IMG/M |
| 3300029319|Ga0183748_1054182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1115 | Open in IMG/M |
| 3300029319|Ga0183748_1057992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1056 | Open in IMG/M |
| 3300029787|Ga0183757_1031955 | Not Available | 1093 | Open in IMG/M |
| 3300029792|Ga0183826_1038043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SCSM1 | 751 | Open in IMG/M |
| 3300031785|Ga0310343_10000348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 21860 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 36.36% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 30.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 5.45% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.55% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.73% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.91% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.91% |
| Surface Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.91% |
| Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559017 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) | Environmental | Open in IMG/M |
| 3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
| 3300001972 | Marine microbial communities from the Sargasso Sea - GS000d | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004831 | Marine surface microbial communities from the North Atlantic Ocean - filtered matter | Environmental | Open in IMG/M |
| 3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020393 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean5-_02464680 | 2166559017 | Environmental And Host-Associated | MIRDALIKASVPITFMVLFLIIGLAPLYVMYGVIDRSIPVKTK |
| GOS2234_10140395 | 3300001964 | Marine | MSKTFLMFKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK* |
| GOS2216_100848673 | 3300001972 | Marine | MIRDALIKASVPITFMVLFLIIGLAPLYVMYGVIDRSIPVKTK* |
| KVWGV2_103942262 | 3300002242 | Marine Sediment | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN* |
| JGI25127J35165_10411052 | 3300002482 | Marine | MSRAFRMIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTKPSR* |
| JGI25128J35275_11189011 | 3300002488 | Marine | MIRDALIKASVPITLMVLFLIIGIAPLYVMYGIIDRNIPI |
| Ga0069134_1668444 | 3300004831 | Surface Seawater | MIKEALIKATVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR* |
| Ga0070431_11683022 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR* |
| Ga0068468_10406903 | 3300006305 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN* |
| Ga0099675_15264944 | 3300006334 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKT |
| Ga0099693_16278123 | 3300006345 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVIYGIIDRNIPVKTN* |
| Ga0098038_10055134 | 3300006735 | Marine | MIKDALIKASVPITFMVLFLIIGLAPLYVMYGILDRNIPVKTQ* |
| Ga0115011_102698953 | 3300009593 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPIKTK* |
| Ga0114933_106677853 | 3300009703 | Deep Subsurface | MIKQALIKASVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN* |
| Ga0114934_102233702 | 3300011013 | Deep Subsurface | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR* |
| Ga0160422_100163476 | 3300012919 | Seawater | MIREALIKASVPIIFMVLFLIIGLAPLYVMYGIIDRNIPVKTR* |
| Ga0160422_100331014 | 3300012919 | Seawater | MFKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTQ* |
| Ga0160422_100409564 | 3300012919 | Seawater | MIRDALIKASVPITLMVLVLIIGLAPLRVMYGVIDKNIPSKTNK* |
| Ga0160422_100576452 | 3300012919 | Seawater | MIREALIKASVPITLMVLFLIIGLAPLYVMYGIIDRNIPVKTQ* |
| Ga0160422_107695491 | 3300012919 | Seawater | MIREALIKASVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN* |
| Ga0160422_111608952 | 3300012919 | Seawater | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPIKSK* |
| Ga0160423_100019297 | 3300012920 | Surface Seawater | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPIKTKPSR* |
| Ga0160423_1001714210 | 3300012920 | Surface Seawater | MIKEALIKASVPITFMVLFLIIGLAPFYVIYGIIDRNIPVKTK* |
| Ga0160423_104936373 | 3300012920 | Surface Seawater | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDKNIPVKTN* |
| Ga0160423_105382693 | 3300012920 | Surface Seawater | EALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKAK* |
| Ga0160423_112066601 | 3300012920 | Surface Seawater | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDKNIPVK |
| Ga0163180_101796212 | 3300012952 | Seawater | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK* |
| Ga0163179_102950223 | 3300012953 | Seawater | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR* |
| Ga0163179_106351893 | 3300012953 | Seawater | MIKEALIKATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN* |
| Ga0163179_107850201 | 3300012953 | Seawater | MIRDALLKASVPITFMVLFLIIGLAPLYVMYGIIDRN |
| Ga0181381_10138991 | 3300017726 | Seawater | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIP |
| Ga0181416_11312464 | 3300017731 | Seawater | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRN |
| Ga0181415_10277983 | 3300017732 | Seawater | MMKDALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0181426_10596251 | 3300017733 | Seawater | MIKEALIKASAPITFMVLFLIIGLAPLYVMYGIIDRI |
| Ga0181426_10700113 | 3300017733 | Seawater | MIKQALIKATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0181428_10280381 | 3300017738 | Seawater | MIKEALIKATVPITFMVLFLIIGLAPLYVMYGIIDKNIPVKTR |
| Ga0181428_10842994 | 3300017738 | Seawater | IKEALIKATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0181428_11313423 | 3300017738 | Seawater | KATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKSN |
| Ga0181433_10688952 | 3300017739 | Seawater | MFKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0181433_11649911 | 3300017739 | Seawater | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPV |
| Ga0181397_11368271 | 3300017744 | Seawater | MIKEAFLKALTPITFMVLFLIIGIAPLYVMYGIIDRNIPVKTR |
| Ga0181411_11040741 | 3300017755 | Seawater | NMIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0181411_12153512 | 3300017755 | Seawater | MIKEALIKATVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0181382_11814731 | 3300017756 | Seawater | KEALIKATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0181409_10441952 | 3300017758 | Seawater | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0181414_11880123 | 3300017759 | Seawater | MIKQALIKATVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0181408_10490453 | 3300017760 | Seawater | NMIKEALIKATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0181408_10922793 | 3300017760 | Seawater | MIKEALIKATVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0181385_10554161 | 3300017764 | Seawater | ASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0181413_10374721 | 3300017765 | Seawater | MIKQALIKASVPISFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0181413_12557932 | 3300017765 | Seawater | ELIKASVPITFMVLFLIIGLAPLYVMYGIIDRNISIHKTP |
| Ga0181406_11703383 | 3300017767 | Seawater | LIKATVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0187220_10387834 | 3300017768 | Seawater | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPV |
| Ga0187221_10794854 | 3300017769 | Seawater | MIKEALIKATVPITFMVLFLIIGLAPLYVMYGIIDRN |
| Ga0187221_11407001 | 3300017769 | Seawater | MIRDALLKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0181430_12009132 | 3300017772 | Seawater | MFKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0181386_10563104 | 3300017773 | Seawater | ASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0181386_11141941 | 3300017773 | Seawater | NMIKQALIKASVPLTFMVLFLIIGLAPLYVMYGIIDRTIPVKTR |
| Ga0181424_101797634 | 3300017786 | Seawater | MFKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDR |
| Ga0211707_10032676 | 3300020246 | Marine | MLKEALIKASVPITFMVLFLIIGLAPLYVMYGVIDRNIPIKTK |
| Ga0211707_10087033 | 3300020246 | Marine | MFRDALIKASVPITFMVLFLIIGLAPLYVMYGVIDRATIQKKVN |
| Ga0211707_10150014 | 3300020246 | Marine | IKEALIKASVPITFMVLFLIIGLAPLRVMYGILDKNIPVKTQ |
| Ga0211483_101864853 | 3300020281 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0211483_103206091 | 3300020281 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0211542_10707562 | 3300020312 | Marine | MIREALIKASVPLTFMVLFLIIGLAPLYVMYGIIDRNIPIKTK |
| Ga0211618_100676222 | 3300020393 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVIYGIIDRNIPVKTN |
| Ga0211497_100674654 | 3300020394 | Marine | MLKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0211472_104038432 | 3300020409 | Marine | KEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0211587_104171321 | 3300020411 | Marine | MIREALIKASVPLTFMVLFLIIGLAPLYVMYGIIDRNIPMKTK |
| Ga0211516_101476663 | 3300020413 | Marine | MIKEALIKATVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0211580_100120554 | 3300020420 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKSQ |
| Ga0211580_100699571 | 3300020420 | Marine | KASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0211702_102430843 | 3300020422 | Marine | LIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKNQ |
| Ga0211565_100099143 | 3300020433 | Marine | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKSQ |
| Ga0211565_100436372 | 3300020433 | Marine | MFKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPIKTQ |
| Ga0211708_100073907 | 3300020436 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKSK |
| Ga0211708_100138994 | 3300020436 | Marine | MFKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0211708_100162173 | 3300020436 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0211708_100265713 | 3300020436 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0211708_100433194 | 3300020436 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKAK |
| Ga0211708_101042261 | 3300020436 | Marine | IKASVPITFMVLFLIIGLAPLYVMYGIIDRSIPVKTN |
| Ga0211539_100085826 | 3300020437 | Marine | MLKEALIKASVPITLMVLFLIIGLAPLRVMYGIIDKNIPVKTR |
| Ga0211576_106813002 | 3300020438 | Marine | MIRDALIKASVPLTFMVLFLIIGIAPLYVMYGVIDRNIPIKTK |
| Ga0211473_100156123 | 3300020451 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKVK |
| Ga0211473_102828662 | 3300020451 | Marine | MIKEALIKATVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTQ |
| Ga0211473_104647482 | 3300020451 | Marine | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0211473_106263591 | 3300020451 | Marine | ALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0211676_104788282 | 3300020463 | Marine | EALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTK |
| Ga0211676_104807652 | 3300020463 | Marine | LDLIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0211577_100472061 | 3300020469 | Marine | MIKEALIKATVPITFMVLFLIIGLAPLYVMYGIID |
| Ga0211577_103387001 | 3300020469 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIID |
| Ga0224906_10050893 | 3300022074 | Seawater | MIKEALIKATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0224906_10100788 | 3300022074 | Seawater | MIKEALIKATVPITFMLLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0224906_11741673 | 3300022074 | Seawater | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIP |
| Ga0224906_11896362 | 3300022074 | Seawater | MIKEALIKATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0208157_100214612 | 3300025086 | Marine | MIKDALIKASVPITFMVLFLIIGLAPLYVMYGILDRNIPVKTQ |
| Ga0209348_10238445 | 3300025127 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTKPSR |
| Ga0209232_10658253 | 3300025132 | Marine | MIKQALIKASVPITFMVLFLIIGLAPLYVIYGIIDRNIPVKTK |
| Ga0209645_11135514 | 3300025151 | Marine | KASVPITFMVLFLIIGLAPLRVMYGIIDRNIPVKTN |
| Ga0209645_11444173 | 3300025151 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDKNIPVKSQ |
| Ga0209404_106855833 | 3300027906 | Marine | MIREALIKASVPITFIVLFLIIGLAPLYVMYGIIDRNIPIKTKPLP |
| Ga0185543_100010550 | 3300029318 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKTR |
| Ga0183748_100185518 | 3300029319 | Marine | MIREALIKASVPITFMVLFLIIGLAPLYVMYGIIDRNIPVKSK |
| Ga0183748_10037626 | 3300029319 | Marine | MIKEALVKATIPITFMVMFLIIGLAPLYVIYGIIDKNIPVKTK |
| Ga0183748_10175623 | 3300029319 | Marine | MIKEALIKASVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTQ |
| Ga0183748_10541822 | 3300029319 | Marine | MIKEALVKATIPITFMVMFLIIGLAPLYVMYGIIDKNIPVKTK |
| Ga0183748_10579924 | 3300029319 | Marine | MIREALIKASVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0183757_10319551 | 3300029787 | Marine | MIKEALSKATVPLTFMVLFLIIGLAPLYVMYGIIDRNIPVKTN |
| Ga0183826_10380432 | 3300029792 | Marine | MIKEALIKASVPITFMVLFLIIGLAPLYVMYGVIDRNIPIKTK |
| Ga0310343_1000034811 | 3300031785 | Seawater | MIKQALIKASVPITFMVLFLIIGLAPLYVMYGVIDRNIPIKTK |
| ⦗Top⦘ |