


| Basic Information | |
|---|---|
| Family ID | F087315 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKL |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 65.45 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 94.55 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (91.818 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (85.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (94.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 91.82 % |
| All Organisms | root | All Organisms | 8.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 85.45% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.82% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.82% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.91% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300006093 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP189 | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006327 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0125m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025043 | Marine viral communities from the Subarctic Pacific Ocean - LP-52 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300026279 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY93_101603422 | 3300000973 | Macroalgal Surface | MIDYNLALYIGIGLIVFGFVLFLVSIHFERKAEIELLN* |
| JGI25129J35166_10449114 | 3300002484 | Marine | MVDYNLVLYFGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQLDKH |
| JGI25128J35275_10932323 | 3300002488 | Marine | MEINYNIVLYIGIALIVGGFILFLIAQHFERQADIRLHKL |
| JGI25133J35611_101070701 | 3300002514 | Marine | MWFDHIINYNIVLYIGIALIVGGFILFLIAQHFEREAEIKLFKLKQLE |
| Ga0066867_102118951 | 3300005400 | Marine | MIDYNLVLYIGIGLIVFGLVLFFVSQHFERQAEIKLFKLE |
| Ga0066867_103591713 | 3300005400 | Marine | MIDYNLALYFGIGLIVFGLVLFFVSQHFERQAEIKLFKLEQLNKS |
| Ga0082019_10410341 | 3300006093 | Marine | MIDYNLVLYFGIGLIVFGLVLFFVSQHFERQAEIKLFKLEQLN |
| Ga0082019_10593801 | 3300006093 | Marine | MIDYNLVLYIGIGLIVFGLVLFFVSQHFERQAEIKLFKLEQLN |
| Ga0068470_12343164 | 3300006308 | Marine | MIDYNLVLYIGIALIVFGFILFLVSEHFERQADIKLFRQEQLT |
| Ga0068499_15487714 | 3300006327 | Marine | MIDYNLVLYIGIGLIVFGFVLFFVAEHFERQAEIKLFKLE |
| Ga0098033_12084713 | 3300006736 | Marine | MIDYNLVLYFGIGLIVFGLVLFFVSQHFERQAEIK |
| Ga0098035_12813043 | 3300006738 | Marine | MIDYNLVLYFGIGLIVFGLVLFFISIHFERQAEIKLFKLE |
| Ga0098040_11378463 | 3300006751 | Marine | MIDYNLVLYIGIALIIGGFILFLIAQHFERQADIRLFKLQQLAK |
| Ga0098040_11824653 | 3300006751 | Marine | MFDYNLALYIGIALIVFGFVLFLVSIHYERQAEIKLFKLEQLA |
| Ga0098040_12462003 | 3300006751 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIELF |
| Ga0098040_12516911 | 3300006751 | Marine | MIDYNLVLYFGIGLIVFGLVLFFISIHFERQAEIKL |
| Ga0098048_11174634 | 3300006752 | Marine | MIDYNLVLYIGVGLIVFGFVLFLVSIHFERQAEIKLFKLE |
| Ga0098048_11492533 | 3300006752 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKQ |
| Ga0098048_12216381 | 3300006752 | Marine | MIDYNLVLYIGMALIIGGFILFLIAQHFERQAEIKL |
| Ga0098039_12158114 | 3300006753 | Marine | MIFNLILYIGIGLIVFGFILFLVAAHFERQAEIKLF |
| Ga0098044_10919934 | 3300006754 | Marine | MFDYNLALYIGIALIVFGFVLFLVSIHYERQAEIKLFKLEQLAKA |
| Ga0098044_10984423 | 3300006754 | Marine | MEINYNLVLYIGIGLIVGGGVLFFVAEHFKRQAEIKLFKLEQLAK |
| Ga0098044_12567561 | 3300006754 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIKLFK |
| Ga0098044_13392863 | 3300006754 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERQAEIK |
| Ga0098054_10943214 | 3300006789 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLE |
| Ga0098054_11149435 | 3300006789 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIKLFKLE |
| Ga0098054_12025653 | 3300006789 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQLDK |
| Ga0098054_12036063 | 3300006789 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKQE |
| Ga0098054_12210023 | 3300006789 | Marine | MEINYNIVLYIGIALIMGGFILFLIAQHFERQAEIKLFKLQQ |
| Ga0098054_12877273 | 3300006789 | Marine | MFDYNLVLYIGVGLIVFGFVLFLVSIHYERQAEIKLFKLEQLA |
| Ga0098054_12961833 | 3300006789 | Marine | MIDYNLVLYIGIALIIGGFILFLIAQHFERQADIRLFKLQQLA |
| Ga0098054_13079633 | 3300006789 | Marine | MIDYNLVLYIGIGLIVGGGVLFFVAQHFERQAEIKLFKLEQ |
| Ga0098055_11918103 | 3300006793 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIKLFKLEQ |
| Ga0098060_12261291 | 3300006921 | Marine | MIDYNLALYFGIGLIVFGFVLFLVSIHFERQAEIK |
| Ga0098053_11013333 | 3300006923 | Marine | MEINYNIVLYIGIGLIIGGFILFLIAQHFERQADIRLFK |
| Ga0098051_11744551 | 3300006924 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKL |
| Ga0098051_11811021 | 3300006924 | Marine | MIDYNLVLYIGVGLIVFGFVLFLVSIHFERQAEIKLFKL |
| Ga0098051_12037701 | 3300006924 | Marine | MIDYYLVLYIGIALIVGGFILFLVASHFERQAEIKL |
| Ga0098050_11412373 | 3300006925 | Marine | MIDHNLVLYIGIGLIVFGFVLFLVSIHFERQEEIKLFKQQQLS |
| Ga0098050_11935421 | 3300006925 | Marine | MEINYNIVLYIGIALFFGGFILFLIAQHFERQAEIRLF |
| Ga0098034_11495133 | 3300006927 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQL |
| Ga0098041_10298551 | 3300006928 | Marine | MINYNLVLYIGVGLIVFGFVLFLVSIHFERQAEIKLFK |
| Ga0098041_12098683 | 3300006928 | Marine | MIDYNLVLYIGIALIIGGFILFLIAQHFERQADIRLFKLQQ |
| Ga0098052_11112331 | 3300008050 | Marine | MWFDHIINYNVVLYIGIALIVGGFILFLIAQHFERQAEIKLFKLEQL |
| Ga0098052_11600701 | 3300008050 | Marine | MIDYNLVLYIGIALIVGGGVLFFVAEHFKRQAEIKLFK |
| Ga0098052_12203783 | 3300008050 | Marine | MINYNIVLYIGIALIVGGFILFLVAEHFKRQADIKLFRQEQL |
| Ga0098052_14030383 | 3300008050 | Marine | MIDYNLVLYFGIGLIVFGLVLFFVSQHFERQAEIKLFKLEQL |
| Ga0114932_107100913 | 3300009481 | Deep Subsurface | MIDYNLVLYIGMGLIVFGFVLFLVSIHFERQAEIKLFKLKQLEE |
| Ga0115011_111524893 | 3300009593 | Marine | MFDYNLVLYFGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQLA |
| Ga0114933_109001902 | 3300009703 | Deep Subsurface | VESEILMIDYNLVLYIGIGLIVFGFVLFLVSAHFEREAEI |
| Ga0098049_10382744 | 3300010149 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERQAEIKLF |
| Ga0098049_11503604 | 3300010149 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKL |
| Ga0098056_10855774 | 3300010150 | Marine | VFFNMIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQ |
| Ga0098056_11864791 | 3300010150 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIKLF |
| Ga0098056_12021213 | 3300010150 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERQAEIKLFKLEQLDKA |
| Ga0098061_10232061 | 3300010151 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERQAEIKLFK |
| Ga0098059_12018153 | 3300010153 | Marine | MIDYNLVLYIGMGLIVFGFVLFLISIHFERKAEIELFK |
| Ga0098059_12591331 | 3300010153 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIKL |
| Ga0098059_12806933 | 3300010153 | Marine | MIDYNIVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQ |
| Ga0098059_13166383 | 3300010153 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIKLFKLEQLD |
| Ga0098059_13651141 | 3300010153 | Marine | MIDYNLVLYIGIGLIVFGFILFLVSEHFERQADIKL |
| Ga0098059_13652511 | 3300010153 | Marine | VFFNMIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLF |
| Ga0098047_102736811 | 3300010155 | Marine | MEINYNLVLYIGIGLIIGGFILFLIAQHFERQAVGQW |
| Ga0133547_121221261 | 3300010883 | Marine | MYNLLLYTGFGLLALGFILFLVSIHFERQQDIKMFK |
| Ga0163108_104570263 | 3300012950 | Seawater | MIDYNLVLYIGIGLIVFGFVLFLVAIHFERQAEIKLFKL |
| Ga0163180_119093693 | 3300012952 | Seawater | MIDYNLVLYIGIGLIIFGFVLFLVATHFQRQAEIKLFKLE |
| Ga0211699_102732383 | 3300020410 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFK |
| (restricted) Ga0255048_106549441 | 3300024518 | Seawater | MIDYNLVLYIGIGLIVFGFVLFLVSEHFERQADIKL |
| Ga0207907_1230681 | 3300025043 | Marine | MYNILLYVGLFFMVGGFILFLVSEHFERQADIKLFRQQQLT |
| Ga0207906_10287753 | 3300025052 | Marine | MYNILLYVGLFFMVGGFILFLVSEHFERQADIKLFRQQQLTK |
| Ga0208012_10040266 | 3300025066 | Marine | MINYNLVLYIGIALIVGGGVLFFVAEHFKRQAEIKLFKLEQLD |
| Ga0208012_10286814 | 3300025066 | Marine | MFDYNLALYIGIALIVFGFVLFLVSIHYERQAEIKLFKLEQ |
| Ga0208920_10982303 | 3300025072 | Marine | MIDYNLVLYFGIGLIVFGLVLFFISIHFERQAEIKLFKL |
| Ga0208298_10460741 | 3300025084 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIKLFKL |
| Ga0208792_10531844 | 3300025085 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIK |
| Ga0208010_10515773 | 3300025097 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVAIHFERKAEIEL |
| Ga0208013_10200834 | 3300025103 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERQAEIKL |
| Ga0208793_10172981 | 3300025108 | Marine | MEINYNLVLYIGIGLIIGGFILFLIAQHFERQADIRLFK |
| Ga0208793_10636861 | 3300025108 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQLD |
| Ga0208793_10741791 | 3300025108 | Marine | MWFDHIINYNMVLYIGIALIVGGFILFLIAQHFERQAEIK |
| Ga0208553_10740191 | 3300025109 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVAIHFERKAEIELF |
| Ga0208158_10137724 | 3300025110 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLF |
| Ga0208158_10192894 | 3300025110 | Marine | MINYNLVLYIGVGLIVFGFVLFLVSIHFERQAEIKLFKLEQLDK |
| Ga0208433_11482183 | 3300025114 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQ |
| Ga0208790_10601533 | 3300025118 | Marine | MEINYNLVLYIGIGLIVGGGVLFFVAEHFKRQAEIKLFK |
| Ga0208790_11190681 | 3300025118 | Marine | MIDYNLVLYIGMGLIVFGFVLFLVSIHFERQAEIKLFKLKQL |
| Ga0208919_10238385 | 3300025128 | Marine | MIDYNLVLYFGIGLIVFGFVLFLISIHFERKAEIKLFKLEQLDK |
| Ga0208919_11274693 | 3300025128 | Marine | MIDYNIVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLEQAY |
| Ga0209128_11010064 | 3300025131 | Marine | MIDYNLVLYFGIGLIVFGLVLFFISIHFERQAEIKLFKLEQ |
| Ga0209128_11335341 | 3300025131 | Marine | MIDYNLVLYIGIALIVFGFVLFLVSIHFERQAEIKLFKLE |
| Ga0209128_11370971 | 3300025131 | Marine | MVDYNLVLYFGIGLIVFGFVLFLVSIHFERQAEIKLFK |
| Ga0208299_10755144 | 3300025133 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFEREAEIKLF |
| Ga0208299_11341431 | 3300025133 | Marine | MIDYNLVLYIGIGLIVFGFVLFLIAIHFERQEEIKQFKLEQL |
| Ga0208299_12308773 | 3300025133 | Marine | MFDYNLALYIGIALIVFGFVLFLVSIHYERQAEIKLFKLEQL |
| Ga0209756_11184774 | 3300025141 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQAEIKLFKLK |
| Ga0209756_13004433 | 3300025141 | Marine | MEINYNIVLYIGIGLIIGGFILFLIAQHFERQADIR |
| Ga0209645_10956381 | 3300025151 | Marine | MIDYNLVLYIGIALIVGGFVLFLVAEHFEREADKKLFRLKQLEDA |
| Ga0209337_11989034 | 3300025168 | Marine | MYNLLLYSGFGLLALGFILFLVSIHFERQQDIKMF |
| Ga0207894_10214365 | 3300025268 | Deep Ocean | MIDYNLVLYFGIGLIVFGLVLFFVSQHFERQAEIKLFKL |
| Ga0208813_10088347 | 3300025270 | Deep Ocean | MIDYNLVLYIGIGLIVFGFVLFLVASHFEREAEIK |
| Ga0209757_102805833 | 3300025873 | Marine | MVDYNLVLYIGIALIVFCFVLFLVSEHLKRKTELKQF |
| Ga0207992_11512393 | 3300026263 | Marine | MIDYNLVLYIGIALIVGGFILFLVASHFERQAEIKLFKLEQ |
| Ga0208641_11502621 | 3300026268 | Marine | MIDYNLVLYFGIGLIVFGLVLFFVSQHFERQAEIKL |
| Ga0208411_11310353 | 3300026279 | Marine | MIDYNLVLYIGIGLIVFGLVLFFVSQHFERQAEIK |
| Ga0209090_103950971 | 3300027813 | Marine | MYNLLLYSGFGLLALGFILFLVSIHFERQQDIKMFKQ |
| (restricted) Ga0255055_106190221 | 3300027881 | Seawater | MIDYNLVLYIGIGLIVFGFVLFLVSIHFERQADIKLFKLEQL |
| Ga0256382_11514141 | 3300028022 | Seawater | MIDYNLVLYIGIGLIVFGFVLFLVSAHFEREAEIKLFKLEQLDKA |
| Ga0257107_10871323 | 3300028192 | Marine | MINYNIVLYIGLFLMVGGFILFLVSEHFERQADIKLFRQQQLTK |
| Ga0183748_10595271 | 3300029319 | Marine | MIDYNLVLYIGIGLIVFGFVLFLVASHFERQAEIKL |
| Ga0315328_105068993 | 3300031757 | Seawater | MIDYNLVLYIGIGLIVFGFVLFLVSEHFERQADIKLFRQEQL |
| ⦗Top⦘ |