


| Basic Information | |
|---|---|
| Family ID | F087227 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 78.18 % |
| Associated GOLD sequencing projects | 51 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.364 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (69.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.50% Coil/Unstructured: 72.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 18.18 |
| PF03237 | Terminase_6N | 1.82 |
| PF13578 | Methyltransf_24 | 1.82 |
| PF11753 | DUF3310 | 0.91 |
| PF00011 | HSP20 | 0.91 |
| PF05050 | Methyltransf_21 | 0.91 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.91 |
| PF02794 | HlyC | 0.91 |
| PF11651 | P22_CoatProtein | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG2994 | ACP:hemolysin acyltransferase (hemolysin-activating protein) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.64 % |
| Unclassified | root | N/A | 46.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10276300 | Not Available | 514 | Open in IMG/M |
| 3300005239|Ga0073579_1531273 | Not Available | 723 | Open in IMG/M |
| 3300006025|Ga0075474_10021574 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300006025|Ga0075474_10022088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2298 | Open in IMG/M |
| 3300006025|Ga0075474_10026483 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 2065 | Open in IMG/M |
| 3300006025|Ga0075474_10030014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 1918 | Open in IMG/M |
| 3300006025|Ga0075474_10197755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 617 | Open in IMG/M |
| 3300006026|Ga0075478_10087206 | Not Available | 1003 | Open in IMG/M |
| 3300006027|Ga0075462_10072153 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300006027|Ga0075462_10201448 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 598 | Open in IMG/M |
| 3300006401|Ga0075506_1788251 | Not Available | 1250 | Open in IMG/M |
| 3300006802|Ga0070749_10324647 | Not Available | 859 | Open in IMG/M |
| 3300006810|Ga0070754_10456095 | Not Available | 554 | Open in IMG/M |
| 3300006867|Ga0075476_10010783 | All Organisms → cellular organisms → Bacteria | 4087 | Open in IMG/M |
| 3300006867|Ga0075476_10059057 | Not Available | 1534 | Open in IMG/M |
| 3300006870|Ga0075479_10002389 | All Organisms → cellular organisms → Bacteria | 8566 | Open in IMG/M |
| 3300006874|Ga0075475_10015306 | All Organisms → Viruses → Predicted Viral | 3820 | Open in IMG/M |
| 3300006874|Ga0075475_10303281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 658 | Open in IMG/M |
| 3300006916|Ga0070750_10041961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2241 | Open in IMG/M |
| 3300006919|Ga0070746_10154826 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300006920|Ga0070748_1358005 | Not Available | 514 | Open in IMG/M |
| 3300007234|Ga0075460_10162279 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 774 | Open in IMG/M |
| 3300007344|Ga0070745_1104622 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1104 | Open in IMG/M |
| 3300007345|Ga0070752_1089253 | Not Available | 1336 | Open in IMG/M |
| 3300007539|Ga0099849_1138848 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 946 | Open in IMG/M |
| 3300007539|Ga0099849_1181658 | Not Available | 800 | Open in IMG/M |
| 3300007539|Ga0099849_1193781 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 767 | Open in IMG/M |
| 3300007540|Ga0099847_1064816 | All Organisms → Viruses | 1136 | Open in IMG/M |
| 3300007960|Ga0099850_1175648 | Not Available | 852 | Open in IMG/M |
| 3300008012|Ga0075480_10146197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1287 | Open in IMG/M |
| 3300009001|Ga0102963_1321407 | Not Available | 608 | Open in IMG/M |
| 3300009001|Ga0102963_1435259 | Not Available | 514 | Open in IMG/M |
| 3300009035|Ga0102958_1322153 | Not Available | 542 | Open in IMG/M |
| 3300009124|Ga0118687_10027256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1876 | Open in IMG/M |
| 3300009124|Ga0118687_10049003 | Not Available | 1410 | Open in IMG/M |
| 3300009515|Ga0129286_10270298 | Not Available | 602 | Open in IMG/M |
| 3300010296|Ga0129348_1016582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2681 | Open in IMG/M |
| 3300010296|Ga0129348_1092980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1066 | Open in IMG/M |
| 3300010296|Ga0129348_1209907 | Not Available | 661 | Open in IMG/M |
| 3300010299|Ga0129342_1326789 | Not Available | 524 | Open in IMG/M |
| 3300010300|Ga0129351_1354120 | Not Available | 550 | Open in IMG/M |
| 3300010316|Ga0136655_1024635 | Not Available | 1984 | Open in IMG/M |
| 3300010354|Ga0129333_10006225 | Not Available | 11292 | Open in IMG/M |
| 3300010354|Ga0129333_10309279 | Not Available | 1413 | Open in IMG/M |
| 3300010354|Ga0129333_10658173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 904 | Open in IMG/M |
| 3300010368|Ga0129324_10000819 | Not Available | 21473 | Open in IMG/M |
| 3300010368|Ga0129324_10088697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1349 | Open in IMG/M |
| 3300010368|Ga0129324_10438476 | Not Available | 502 | Open in IMG/M |
| 3300010430|Ga0118733_108228962 | Not Available | 539 | Open in IMG/M |
| 3300013010|Ga0129327_10206251 | Not Available | 993 | Open in IMG/M |
| 3300017697|Ga0180120_10009776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4630 | Open in IMG/M |
| 3300017697|Ga0180120_10049191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1906 | Open in IMG/M |
| 3300017697|Ga0180120_10400217 | Not Available | 539 | Open in IMG/M |
| 3300019756|Ga0194023_1103582 | Not Available | 575 | Open in IMG/M |
| 3300019764|Ga0193963_1181061 | Not Available | 537 | Open in IMG/M |
| 3300019937|Ga0194022_1002923 | Not Available | 2218 | Open in IMG/M |
| 3300019938|Ga0194032_1034362 | Not Available | 532 | Open in IMG/M |
| 3300021958|Ga0222718_10016637 | All Organisms → cellular organisms → Bacteria | 5213 | Open in IMG/M |
| 3300021958|Ga0222718_10330076 | All Organisms → Viruses | 782 | Open in IMG/M |
| 3300022050|Ga0196883_1029880 | Not Available | 662 | Open in IMG/M |
| 3300022057|Ga0212025_1001067 | Not Available | 2609 | Open in IMG/M |
| 3300022057|Ga0212025_1021338 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300022063|Ga0212029_1014792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1003 | Open in IMG/M |
| 3300022069|Ga0212026_1026106 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 843 | Open in IMG/M |
| 3300022069|Ga0212026_1061312 | Not Available | 570 | Open in IMG/M |
| 3300022071|Ga0212028_1013444 | Not Available | 1353 | Open in IMG/M |
| 3300022071|Ga0212028_1072571 | Not Available | 644 | Open in IMG/M |
| 3300022158|Ga0196897_1021767 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 783 | Open in IMG/M |
| 3300022167|Ga0212020_1016901 | All Organisms → Viruses | 1150 | Open in IMG/M |
| 3300022169|Ga0196903_1009753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1198 | Open in IMG/M |
| 3300022198|Ga0196905_1016136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2394 | Open in IMG/M |
| 3300022198|Ga0196905_1030820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1612 | Open in IMG/M |
| 3300022198|Ga0196905_1063595 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1026 | Open in IMG/M |
| 3300022198|Ga0196905_1104660 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 752 | Open in IMG/M |
| 3300022198|Ga0196905_1121126 | Not Available | 686 | Open in IMG/M |
| 3300022200|Ga0196901_1046004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1647 | Open in IMG/M |
| 3300025508|Ga0208148_1110801 | Not Available | 578 | Open in IMG/M |
| 3300025508|Ga0208148_1122657 | Not Available | 534 | Open in IMG/M |
| 3300025543|Ga0208303_1008475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3291 | Open in IMG/M |
| 3300025543|Ga0208303_1013629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2443 | Open in IMG/M |
| 3300025543|Ga0208303_1077194 | Not Available | 745 | Open in IMG/M |
| 3300025610|Ga0208149_1032092 | All Organisms → Viruses | 1434 | Open in IMG/M |
| 3300025610|Ga0208149_1066259 | Not Available | 908 | Open in IMG/M |
| 3300025630|Ga0208004_1015369 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 2472 | Open in IMG/M |
| 3300025646|Ga0208161_1000797 | Not Available | 17444 | Open in IMG/M |
| 3300025646|Ga0208161_1036936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1668 | Open in IMG/M |
| 3300025647|Ga0208160_1057216 | Not Available | 1090 | Open in IMG/M |
| 3300025647|Ga0208160_1154876 | Not Available | 551 | Open in IMG/M |
| 3300025652|Ga0208134_1104530 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300025655|Ga0208795_1095303 | Not Available | 805 | Open in IMG/M |
| 3300025671|Ga0208898_1046177 | Not Available | 1622 | Open in IMG/M |
| 3300025671|Ga0208898_1060922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1308 | Open in IMG/M |
| 3300025671|Ga0208898_1155889 | Not Available | 610 | Open in IMG/M |
| 3300025687|Ga0208019_1039236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1705 | Open in IMG/M |
| 3300025751|Ga0208150_1035836 | All Organisms → Viruses → Predicted Viral | 1722 | Open in IMG/M |
| 3300025759|Ga0208899_1053960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1704 | Open in IMG/M |
| 3300025771|Ga0208427_1193036 | Not Available | 651 | Open in IMG/M |
| 3300025803|Ga0208425_1057828 | All Organisms → Viruses | 956 | Open in IMG/M |
| 3300025810|Ga0208543_1076559 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 809 | Open in IMG/M |
| 3300025818|Ga0208542_1105042 | All Organisms → Viruses | 808 | Open in IMG/M |
| 3300025853|Ga0208645_1007350 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 7178 | Open in IMG/M |
| 3300025889|Ga0208644_1338860 | All Organisms → Viruses | 579 | Open in IMG/M |
| 3300026187|Ga0209929_1130510 | Not Available | 628 | Open in IMG/M |
| 3300027917|Ga0209536_100847684 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300031565|Ga0307379_10603671 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1005 | Open in IMG/M |
| 3300034374|Ga0348335_036630 | All Organisms → Viruses | 2069 | Open in IMG/M |
| 3300034374|Ga0348335_103699 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300034375|Ga0348336_002790 | Not Available | 13893 | Open in IMG/M |
| 3300034375|Ga0348336_005875 | Not Available | 8392 | Open in IMG/M |
| 3300034375|Ga0348336_006130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8171 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 69.09% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 14.55% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.73% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.73% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 2.73% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.82% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.91% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019764 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_6_MG | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102763003 | 3300000101 | Marine | NAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0073579_15312731 | 3300005239 | Marine | LSTVIFNAINVIPEKSDIYVSGKGSSNSSASASFDLLLVQDGY* |
| Ga0075474_100215741 | 3300006025 | Aqueous | VIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0075474_100220886 | 3300006025 | Aqueous | AINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0075474_100264831 | 3300006025 | Aqueous | AINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0075474_100300148 | 3300006025 | Aqueous | TTVIFNAINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY* |
| Ga0075474_101977553 | 3300006025 | Aqueous | QTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0075478_100872061 | 3300006026 | Aqueous | NVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY* |
| Ga0075462_100721534 | 3300006027 | Aqueous | FLNVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0075462_102014481 | 3300006027 | Aqueous | NVRGGQTTVIFNAINVIPQKSDIYVSGNASSNSSASASFDLLLVQDGY* |
| Ga0075506_17882514 | 3300006401 | Aqueous | GGQTTVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0070749_103246471 | 3300006802 | Aqueous | AINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0070754_104560951 | 3300006810 | Aqueous | QFLNVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0075476_100107831 | 3300006867 | Aqueous | NVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0075476_100590574 | 3300006867 | Aqueous | NVIPQKADIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0075479_100023891 | 3300006870 | Aqueous | VRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0075475_100153065 | 3300006874 | Aqueous | VIFNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0075475_103032811 | 3300006874 | Aqueous | VRGGQTTVIFNSINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY* |
| Ga0070750_100419611 | 3300006916 | Aqueous | QFLDVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0070746_101548266 | 3300006919 | Aqueous | IFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0070748_13580051 | 3300006920 | Aqueous | FLNVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0075460_101622794 | 3300007234 | Aqueous | NVIPQKSDIYVSALASSTSSASASFDLLLVQDGY* |
| Ga0070745_11046221 | 3300007344 | Aqueous | GQTTVIFNSINVIPEKSDIYISGKSSSTSSASASFDLLLVQDGY* |
| Ga0070752_10892534 | 3300007345 | Aqueous | GGQTTVIFNAINVIPQKSDIYVSAISSSTSSASASFDLLLVQDGY* |
| Ga0099849_11388481 | 3300007539 | Aqueous | FNAINVIPEKADIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0099849_11816583 | 3300007539 | Aqueous | GETTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0099849_11937811 | 3300007539 | Aqueous | KQFLDVRGGQTTVIFNAISVIPEKSDIYISALASSTSSASASFDLLLVQDGY* |
| Ga0099847_10648161 | 3300007540 | Aqueous | FNAINVIPQKSDIYVSGKASSTSSASATFDLLLVQDGY* |
| Ga0099850_11756481 | 3300007960 | Aqueous | AINVIPQKADIYVSALANSTSSASASFDLLLVQDGY* |
| Ga0075480_101461971 | 3300008012 | Aqueous | TTVIFNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0102963_13214071 | 3300009001 | Pond Water | INVIPEKSDIYISGKASSTSSASASFDLLLVQDGY* |
| Ga0102963_14352591 | 3300009001 | Pond Water | QTTVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY* |
| Ga0102958_13221531 | 3300009035 | Soil | RGGQTTVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY* |
| Ga0118687_100272561 | 3300009124 | Sediment | LDVRGGQTTVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY* |
| Ga0118687_100490031 | 3300009124 | Sediment | LDVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0129286_102702981 | 3300009515 | Sediment | TTVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY* |
| Ga0129348_10165826 | 3300010296 | Freshwater To Marine Saline Gradient | FNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY* |
| Ga0129348_10929801 | 3300010296 | Freshwater To Marine Saline Gradient | NVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY* |
| Ga0129348_12099071 | 3300010296 | Freshwater To Marine Saline Gradient | VIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0129342_13267891 | 3300010299 | Freshwater To Marine Saline Gradient | NAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY* |
| Ga0129351_13541203 | 3300010300 | Freshwater To Marine Saline Gradient | TTVIFNAINVIPQKSDIYVSAIASSTSSSSASFDLLLVQDGY* |
| Ga0136655_10246354 | 3300010316 | Freshwater To Marine Saline Gradient | FNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0129333_100062251 | 3300010354 | Freshwater To Marine Saline Gradient | TVIFNAISVIPEKSDIYISALASSTSSASASFDLLLVQDGY* |
| Ga0129333_103092791 | 3300010354 | Freshwater To Marine Saline Gradient | GQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLIQDGY* |
| Ga0129333_106581731 | 3300010354 | Freshwater To Marine Saline Gradient | INVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY* |
| Ga0129324_100008191 | 3300010368 | Freshwater To Marine Saline Gradient | TTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0129324_100886975 | 3300010368 | Freshwater To Marine Saline Gradient | GGQTTVIFNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY* |
| Ga0129324_104384762 | 3300010368 | Freshwater To Marine Saline Gradient | NAINVIPQKSDIYVSAIASSTSSASATFDLLLVQDGY* |
| Ga0118733_1082289621 | 3300010430 | Marine Sediment | QFLNVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY* |
| Ga0129327_102062511 | 3300013010 | Freshwater To Marine Saline Gradient | INVIPEKSDIYVSGKGSSTSSASASFDLLLVQDGY* |
| Ga0180120_100097761 | 3300017697 | Freshwater To Marine Saline Gradient | TTVMFNAINVIPQKSDIYVSGKASSNSSASASFDLLLVQDGY |
| Ga0180120_100491915 | 3300017697 | Freshwater To Marine Saline Gradient | NAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY |
| Ga0180120_104002171 | 3300017697 | Freshwater To Marine Saline Gradient | AINVIPQKSDIYVSGKASSTSSASATFDLLLVQDGY |
| Ga0194023_11035821 | 3300019756 | Freshwater | TVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0193963_11810611 | 3300019764 | Freshwater Microbial Mat | VRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0194022_10029234 | 3300019937 | Freshwater | IFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0194032_10343621 | 3300019938 | Freshwater | INVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0222718_100166371 | 3300021958 | Estuarine Water | TTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0222718_103300764 | 3300021958 | Estuarine Water | VIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY |
| Ga0196883_10298803 | 3300022050 | Aqueous | LFIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0212025_10010674 | 3300022057 | Aqueous | KRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0212025_10213385 | 3300022057 | Aqueous | DVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0212029_10147924 | 3300022063 | Aqueous | NSINVIPQKSDIYVSAIASSTSSSSASFDLLLVQDGY |
| Ga0212026_10261064 | 3300022069 | Aqueous | NAINVIPQKSDIYVSGKASSNSSASASFDLLLVQDGY |
| Ga0212026_10613123 | 3300022069 | Aqueous | AINVIPEKADIYVSALASSTSSASASFDLLLVQDGY |
| Ga0212028_10134441 | 3300022071 | Aqueous | TVIFNAINIIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0212028_10725713 | 3300022071 | Aqueous | LDVRGGQTTVIFNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY |
| Ga0196897_10217674 | 3300022158 | Aqueous | AINVIPQKSDIYVSAISSSTSSASASFDLLLVQDGY |
| Ga0212020_10169011 | 3300022167 | Aqueous | VRGGQTTVIFNAINVIPQKSDIYVSAISSSTSSASASFDLLLVQDGY |
| Ga0196903_10097534 | 3300022169 | Aqueous | LNVRGGETTVMFNAINVIPQKSDIYVSGKASSNSSASASFDLLLVQDGY |
| Ga0196905_10161361 | 3300022198 | Aqueous | TTVIFNAVTVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0196905_10308205 | 3300022198 | Aqueous | INVIPQKSDIYVSAIASSTSSASATFDLLLVQDGY |
| Ga0196905_10635953 | 3300022198 | Aqueous | IFNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY |
| Ga0196905_11046604 | 3300022198 | Aqueous | GQTTVIFNAINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY |
| Ga0196905_11211263 | 3300022198 | Aqueous | VIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0196901_10460045 | 3300022200 | Aqueous | GQTTVIFNAINVIPEKADIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0208148_11108011 | 3300025508 | Aqueous | NAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0208148_11226571 | 3300025508 | Aqueous | NAINVIPEKSDIYVSGKGSSTSSASASFDLLLVQDGY |
| Ga0208303_10084757 | 3300025543 | Aqueous | FNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY |
| Ga0208303_10136295 | 3300025543 | Aqueous | LDVRGGQTTVIFNAINVIPQKSDIYISALASSTSSASASFDLLLVQDGY |
| Ga0208303_10771944 | 3300025543 | Aqueous | INVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0208149_10320921 | 3300025610 | Aqueous | VRGGQTTVIFNSINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY |
| Ga0208149_10662591 | 3300025610 | Aqueous | VRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLIQDGY |
| Ga0208004_10153691 | 3300025630 | Aqueous | VRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0208161_100079726 | 3300025646 | Aqueous | RGGQTTVIFNAINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY |
| Ga0208161_10369361 | 3300025646 | Aqueous | QFLNVRGGQTNVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0208160_10572164 | 3300025647 | Aqueous | INVISQKSDIYVSGLASSTSSASASFDLLLVQDGY |
| Ga0208160_11548761 | 3300025647 | Aqueous | IFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0208134_11045304 | 3300025652 | Aqueous | FNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0208795_10953032 | 3300025655 | Aqueous | TVVFNAVSVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY |
| Ga0208898_10461774 | 3300025671 | Aqueous | INVIPQKSDIYVSGLASSTSSASASFDLLLVQDGY |
| Ga0208898_10609221 | 3300025671 | Aqueous | VRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0208898_11558893 | 3300025671 | Aqueous | VIFNAINIIPQKSDIYVSGKGSSTSSASASFDLLLVQDGY |
| Ga0208019_10392361 | 3300025687 | Aqueous | AINVIPQKADIYVSALANSTSSASASFDLLLVQDGY |
| Ga0208150_10358361 | 3300025751 | Aqueous | NVRGGQTTVIFNAINVISEKSDIYISGKASSTSSSSASFDLLLVQDGY |
| Ga0208899_10539606 | 3300025759 | Aqueous | VIFNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0208427_11930362 | 3300025771 | Aqueous | TTVIFNAINVIPHKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0208425_10578284 | 3300025803 | Aqueous | TVIFNAINVIPEKADIYVSALASSTSSASASFDLLLVQDGY |
| Ga0208543_10765594 | 3300025810 | Aqueous | GQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0208542_11050421 | 3300025818 | Aqueous | AINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0208645_100735011 | 3300025853 | Aqueous | IFNAINVIPHKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0208644_13388603 | 3300025889 | Aqueous | IFNAINVIPQKSDIYVSGKASSNSSSSASFDLLLVQDGY |
| Ga0209929_11305101 | 3300026187 | Pond Water | VRGGQTTVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY |
| Ga0209536_1008476841 | 3300027917 | Marine Sediment | RGGQTTVIFNAINVIPQKSDIYVSAISSSTSSASASFDLLLVQDGY |
| Ga0307379_106036714 | 3300031565 | Soil | IFNAINIIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0348335_036630_1958_2068 | 3300034374 | Aqueous | AINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0348335_103699_1_123 | 3300034374 | Aqueous | VIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY |
| Ga0348336_002790_13760_13891 | 3300034375 | Aqueous | QTTVIFNSINVIPEKSDIYISGKSSSTSSASASFDLLLVQDGY |
| Ga0348336_005875_8248_8391 | 3300034375 | Aqueous | VRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY |
| Ga0348336_006130_1_147 | 3300034375 | Aqueous | NVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY |
| ⦗Top⦘ |