


| Basic Information | |
|---|---|
| Family ID | F087103 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MKLICDDYNQVYVWVDDVDENLELSPHFDYEEDAVAWKERMKQELSK |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 72.38 % |
| % of genes near scaffold ends (potentially truncated) | 9.09 % |
| % of genes from short scaffolds (< 2000 bps) | 56.36 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (43.636 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (10.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.33% β-sheet: 16.00% Coil/Unstructured: 62.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00004 | AAA | 3.64 |
| PF02739 | 5_3_exonuc_N | 3.64 |
| PF11750 | DUF3307 | 2.73 |
| PF00574 | CLP_protease | 2.73 |
| PF00149 | Metallophos | 2.73 |
| PF01242 | PTPS | 2.73 |
| PF05496 | RuvB_N | 2.73 |
| PF13186 | SPASM | 1.82 |
| PF07460 | NUMOD3 | 1.82 |
| PF01467 | CTP_transf_like | 1.82 |
| PF04321 | RmlD_sub_bind | 1.82 |
| PF00294 | PfkB | 0.91 |
| PF01555 | N6_N4_Mtase | 0.91 |
| PF13392 | HNH_3 | 0.91 |
| PF13489 | Methyltransf_23 | 0.91 |
| PF04055 | Radical_SAM | 0.91 |
| PF00521 | DNA_topoisoIV | 0.91 |
| PF07733 | DNA_pol3_alpha | 0.91 |
| PF16363 | GDP_Man_Dehyd | 0.91 |
| PF10902 | WYL_2 | 0.91 |
| PF04434 | SWIM | 0.91 |
| PF01165 | Ribosomal_S21 | 0.91 |
| PF05175 | MTS | 0.91 |
| PF13517 | FG-GAP_3 | 0.91 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.91 |
| PF01171 | ATP_bind_3 | 0.91 |
| PF00692 | dUTPase | 0.91 |
| PF01176 | eIF-1a | 0.91 |
| PF01648 | ACPS | 0.91 |
| PF08804 | gp32 | 0.91 |
| PF05265 | DUF723 | 0.91 |
| PF13524 | Glyco_trans_1_2 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 5.45 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 5.45 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 3.64 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 3.64 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 3.64 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 3.64 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 2.73 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.73 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 2.73 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 1.82 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.91 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.91 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.91 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.91 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.91 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.91 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.91 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.91 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.91 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.91 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.91 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.27 % |
| Unclassified | root | N/A | 32.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000558|Draft_10181741 | All Organisms → Viruses → Predicted Viral | 3576 | Open in IMG/M |
| 3300000558|Draft_11496186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300000558|Draft_11822170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300001580|Draft_10001866 | Not Available | 21926 | Open in IMG/M |
| 3300001848|RCM47_1131091 | Not Available | 731 | Open in IMG/M |
| 3300001850|RCM37_1138526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300002161|JGI24766J26685_10051804 | Not Available | 921 | Open in IMG/M |
| 3300002202|metazooDRAFT_1230162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300002408|B570J29032_108880009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300003277|JGI25908J49247_10007556 | All Organisms → Viruses → Predicted Viral | 3435 | Open in IMG/M |
| 3300003277|JGI25908J49247_10032612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1463 | Open in IMG/M |
| 3300003393|JGI25909J50240_1002943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4346 | Open in IMG/M |
| 3300003412|JGI25912J50252_10013408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2694 | Open in IMG/M |
| 3300003806|Ga0007864_1001274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2923 | Open in IMG/M |
| 3300004481|Ga0069718_13471761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300004481|Ga0069718_14703392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300005077|Ga0071116_1004164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16858 | Open in IMG/M |
| 3300005662|Ga0078894_10327023 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
| 3300005662|Ga0078894_11013333 | Not Available | 714 | Open in IMG/M |
| 3300005805|Ga0079957_1010490 | Not Available | 6999 | Open in IMG/M |
| 3300006029|Ga0075466_1005770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4406 | Open in IMG/M |
| 3300006030|Ga0075470_10002328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5912 | Open in IMG/M |
| 3300006037|Ga0075465_10048602 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300006639|Ga0079301_1151405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300006805|Ga0075464_10009845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4680 | Open in IMG/M |
| 3300007169|Ga0102976_1028908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1660 | Open in IMG/M |
| 3300007171|Ga0102977_1146400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
| 3300007559|Ga0102828_1049114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300007960|Ga0099850_1165386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300008107|Ga0114340_1006273 | Not Available | 6242 | Open in IMG/M |
| 3300008110|Ga0114343_1014446 | All Organisms → Viruses → Predicted Viral | 3685 | Open in IMG/M |
| 3300008113|Ga0114346_1006019 | Not Available | 12853 | Open in IMG/M |
| 3300009081|Ga0105098_10013354 | All Organisms → Viruses → Predicted Viral | 3058 | Open in IMG/M |
| 3300009085|Ga0105103_10049203 | All Organisms → Viruses → Predicted Viral | 2126 | Open in IMG/M |
| 3300009165|Ga0105102_10271987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
| 3300009169|Ga0105097_10208552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300009243|Ga0103860_10060629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300009419|Ga0114982_1000013 | Not Available | 80174 | Open in IMG/M |
| 3300009419|Ga0114982_1070120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
| 3300010354|Ga0129333_10003513 | Not Available | 14680 | Open in IMG/M |
| 3300010354|Ga0129333_10033450 | Not Available | 4855 | Open in IMG/M |
| 3300010354|Ga0129333_10034908 | Not Available | 4747 | Open in IMG/M |
| 3300010354|Ga0129333_10061773 | Not Available | 3492 | Open in IMG/M |
| 3300010354|Ga0129333_10124016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2379 | Open in IMG/M |
| 3300010354|Ga0129333_10129002 | All Organisms → Viruses → Predicted Viral | 2326 | Open in IMG/M |
| 3300010354|Ga0129333_10220172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1721 | Open in IMG/M |
| 3300010354|Ga0129333_11562071 | Not Available | 539 | Open in IMG/M |
| 3300012006|Ga0119955_1164186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Helicobacteraceae → Helicobacter | 575 | Open in IMG/M |
| 3300012348|Ga0157140_10000014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 43729 | Open in IMG/M |
| 3300012665|Ga0157210_1000446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17508 | Open in IMG/M |
| 3300012665|Ga0157210_1036069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300012665|Ga0157210_1068141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300012933|Ga0157211_1014863 | Not Available | 788 | Open in IMG/M |
| 3300013004|Ga0164293_10848974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300013005|Ga0164292_10729903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300013285|Ga0136642_1000905 | Not Available | 13925 | Open in IMG/M |
| 3300013372|Ga0177922_10157772 | Not Available | 659 | Open in IMG/M |
| 3300017722|Ga0181347_1198693 | Not Available | 528 | Open in IMG/M |
| 3300017788|Ga0169931_10095276 | All Organisms → Viruses → Predicted Viral | 2886 | Open in IMG/M |
| 3300020048|Ga0207193_1726122 | Not Available | 652 | Open in IMG/M |
| 3300020151|Ga0211736_10909865 | Not Available | 503 | Open in IMG/M |
| 3300020160|Ga0211733_10257650 | All Organisms → Viruses | 1076 | Open in IMG/M |
| 3300020161|Ga0211726_10183309 | Not Available | 1443 | Open in IMG/M |
| 3300020172|Ga0211729_10680746 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300020222|Ga0194125_10192808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1473 | Open in IMG/M |
| 3300020527|Ga0208232_1023564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300021963|Ga0222712_10002918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19133 | Open in IMG/M |
| 3300021963|Ga0222712_10004732 | Not Available | 14102 | Open in IMG/M |
| 3300021963|Ga0222712_10019095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5778 | Open in IMG/M |
| 3300021963|Ga0222712_10027022 | All Organisms → Viruses → Predicted Viral | 4621 | Open in IMG/M |
| 3300021963|Ga0222712_10258126 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
| 3300021963|Ga0222712_10335775 | Not Available | 936 | Open in IMG/M |
| 3300021963|Ga0222712_10455394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300021963|Ga0222712_10794871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 522 | Open in IMG/M |
| 3300022072|Ga0196889_1037272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300022198|Ga0196905_1117353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300022200|Ga0196901_1244868 | Not Available | 558 | Open in IMG/M |
| 3300022748|Ga0228702_1135181 | Not Available | 548 | Open in IMG/M |
| 3300024346|Ga0244775_10764428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300025357|Ga0208383_1003183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2346 | Open in IMG/M |
| 3300025451|Ga0208426_1027531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300025451|Ga0208426_1049867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300025585|Ga0208546_1011827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2286 | Open in IMG/M |
| 3300025896|Ga0208916_10007275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4331 | Open in IMG/M |
| 3300027721|Ga0209492_1091507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1072 | Open in IMG/M |
| 3300027785|Ga0209246_10000428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17955 | Open in IMG/M |
| 3300027805|Ga0209229_10093537 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300027805|Ga0209229_10112546 | Not Available | 1227 | Open in IMG/M |
| 3300027805|Ga0209229_10471304 | Not Available | 538 | Open in IMG/M |
| 3300027956|Ga0209820_1028422 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300029930|Ga0119944_1009659 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300031758|Ga0315907_10376100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
| 3300031786|Ga0315908_10315978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
| 3300031857|Ga0315909_10029003 | Not Available | 5400 | Open in IMG/M |
| 3300031857|Ga0315909_10216498 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
| 3300033992|Ga0334992_0000038 | Not Available | 121667 | Open in IMG/M |
| 3300034061|Ga0334987_0017178 | Not Available | 6577 | Open in IMG/M |
| 3300034063|Ga0335000_0640212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300034073|Ga0310130_0000959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17403 | Open in IMG/M |
| 3300034073|Ga0310130_0002434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8687 | Open in IMG/M |
| 3300034082|Ga0335020_0044716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2357 | Open in IMG/M |
| 3300034093|Ga0335012_0000862 | Not Available | 19869 | Open in IMG/M |
| 3300034095|Ga0335022_0575162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300034101|Ga0335027_0253351 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300034102|Ga0335029_0000004 | Not Available | 359425 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.91% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.27% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.27% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 4.55% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 3.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.64% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 3.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.73% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.73% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.73% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.82% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.82% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.91% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.91% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.91% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.91% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.91% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.91% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.91% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.91% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.91% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012933 | Freshwater microbial communities from Tributary to Mariposa, Ontario, Canada - S7 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_101817411 | 3300000558 | Hydrocarbon Resource Environments | DDYNQIYVWIDDNDENVELSPHFDYLEDAEQWFQRIKQEVTK* |
| Draft_114961861 | 3300000558 | Hydrocarbon Resource Environments | MKLLYDDYNQIYVWVDDHNEDDELSPHFDYEEDAEQWFLRIKEEVTK* |
| Draft_118221701 | 3300000558 | Hydrocarbon Resource Environments | KLLYDDYNQIYVWIDDNDENVELSPHFDYLEDAEQWFQRIKQEVTK* |
| Draft_1000186635 | 3300001580 | Hydrocarbon Resource Environments | MKLLYDDYNQIYVWIDDNDENVELSPHFDYLEDAEQWFQRIKQEVTK* |
| RCM47_11310913 | 3300001848 | Marine Plankton | MKLLYDDYNQIYVWVDDNNEDHELSPRFDYEEDAAQWFDRMKQEVNKDGKR* |
| RCM37_11385262 | 3300001850 | Marine Plankton | MKMLYDDINQIYVWVDDEDENIQLSPHFDYEEDAEQWFIRMKQELNLKQ* |
| JGI24766J26685_100518042 | 3300002161 | Freshwater And Sediment | MKMLYDDYNTVYMWVDDQDENIELSPRFDYVEDCEEWFHRMKKELNNDKH* |
| metazooDRAFT_12301622 | 3300002202 | Lake | VTMKLLCDDRNQVYVWVDDDNEDIHLSPRFDYEEDAENWYKQIKKKVQDEKNLL* |
| B570J29032_1088800092 | 3300002408 | Freshwater | MKLLHDDYNLVYVWVDDDNEDIELSPHFDYEEDADQWFERMKKEVTKNER* |
| JGI25908J49247_100075567 | 3300003277 | Freshwater Lake | MTLILDDYNQVYVWVDDVEHNRQLSPCFDYEEDALQWKERMKKELEE* |
| JGI25908J49247_100326126 | 3300003277 | Freshwater Lake | MILICDDYNEIYVWVDDNDHNHELSPHFDYEEDAHVWKERMKKEMLK* |
| JGI25909J50240_10029435 | 3300003393 | Freshwater Lake | MTXILDDYNQVYVWVDDVEHNRQLSPCFDYEEDALQWKERMKKELEE* |
| JGI25912J50252_100134082 | 3300003412 | Freshwater Lake | MTLILDDYNQVYVWVDDVEHNRQLSPCXDYEEDALQWKERMKKELEE* |
| Ga0007864_10012747 | 3300003806 | Freshwater | MKLLCDDFNEVYIWVDDYDENIEFSPHFDYEEDALLWRERMKQELIK* |
| Ga0069718_134717612 | 3300004481 | Sediment | MKLILDDYNQIYVWVEDHNEDLELSPHFDYEEDAIRWRDRMKQELLKERK* |
| Ga0069718_147033922 | 3300004481 | Sediment | MKLLCDDYKEIYVWVDDLDEDHELSPHFDYEEDAVRWRDRMKQELLREKK* |
| Ga0071116_100416411 | 3300005077 | Sinkhole | MKLLCDDFNEVYVWVDDWDENIELSPHFDYEEDAIQWRDRMKELLNDQNT* |
| Ga0078894_103270232 | 3300005662 | Freshwater Lake | MKLLCDDYKEVYVWVDDMDEDIELSPHFDYEEDAIRWRDRMKQELLREKK* |
| Ga0078894_110133332 | 3300005662 | Freshwater Lake | MKLICDDYNQVYVWVDDNNEDHELSPKFDYEEDALEWKERIKEELKK* |
| Ga0079957_10104902 | 3300005805 | Lake | MKLFCDDLLQVYVWVEDHDENIELSPHFDYEEDAFQWRDRVKELLSKNNLGYIKL* |
| Ga0075466_100577010 | 3300006029 | Aqueous | MKLLEDEFNGVYVWVEELDENIELSPHFDYEEDAIQWRDTMKAKLANFG* |
| Ga0075470_1000232810 | 3300006030 | Aqueous | MKLISDEFQGVYVWVDDENHDDELSPHFDYEEDAIQWKERIKQELYNKSE* |
| Ga0075465_100486022 | 3300006037 | Aqueous | MKLFEDEFNGIYVWVDELDENIELSPHFDYEDDAIQWRDTMKSKLG* |
| Ga0079301_11514051 | 3300006639 | Deep Subsurface | MKLLADDYKEIYVWVDDLDEDYELSPHFDYEEDAIRWRDRMKQELLREKK* |
| Ga0075464_100098457 | 3300006805 | Aqueous | MQRLKMILICDDYNEIYVWVDDNDHNHELSPHFDYEEDAHVWKERMKKEMLK* |
| Ga0102976_10289082 | 3300007169 | Freshwater Lake | MKLLCDDHNQVYVWVSDLDENDELSPHFDYEEDAALWKERMSAEVLRESGFVPDDWK* |
| Ga0102977_11464004 | 3300007171 | Freshwater Lake | MKLILDDYNGVYVWVADEDEDDELSPHFDYEEDALQWKQRMEALLKQ* |
| Ga0102828_10491143 | 3300007559 | Estuarine | MILICDDYNEVYIWVDDEDHDHELSPHFDYEDDALEWRERIKKEVS* |
| Ga0099850_11653862 | 3300007960 | Aqueous | MRLICDDFQNVYVWVEDHDENIELSPHFDYEEDAIQWKLRIEQLLKEQYVSTN* |
| Ga0114340_10062736 | 3300008107 | Freshwater, Plankton | MKLLCDDINQIYVWVDDSDEDIELSPHFDYEEDAADWRERMKRELDDKGNY* |
| Ga0114343_10144468 | 3300008110 | Freshwater, Plankton | MKLLCDDINQIYVWVDDSDENIELSPHFDYEEDAADWRERMKRELDDEGNY* |
| Ga0114346_10060197 | 3300008113 | Freshwater, Plankton | MKLLCDDINQIYVWVDDSDENIELSPHFDYEEDAADWRERMKRELDDKGNY* |
| Ga0105098_100133545 | 3300009081 | Freshwater Sediment | MKLLCDDHKEIYVWVDDMDEDVELSPHFDYEEDAVRWRDRMKQELLKEKK* |
| Ga0105103_100492033 | 3300009085 | Freshwater Sediment | MQLICDEIQNVYVWVEDHDENIELSPHFDYEEDALIWKDRIEKLLKE* |
| Ga0105102_102719872 | 3300009165 | Freshwater Sediment | MRLICDDFQNVYVWVEDHDENIELSPHFDYEEDALQWKLRIEQLLKE* |
| Ga0105097_102085522 | 3300009169 | Freshwater Sediment | MKLICDDYNQIYVWVEDMDDNAELSPHFDYEEDALQWRNRVTELILKEKNAKS* |
| Ga0103860_100606292 | 3300009243 | River Water | MRLICDDYNQVYIWVEDFDENIELSPRFDYEEDAIQWKNRIEDLLKETK* |
| Ga0114982_100001364 | 3300009419 | Deep Subsurface | MKLLCDDYKEVYVWVDDLDEDHELSPHFDYEEDAIRWRDRMKQELLREKK* |
| Ga0114982_10701202 | 3300009419 | Deep Subsurface | MILICDDYNEIYVWVDDNDQDLELSPHFDYEEDAHEWKERMKKEVNK* |
| Ga0129333_1000351310 | 3300010354 | Freshwater To Marine Saline Gradient | MRLICDDYNQIYVWVEDLDENIELSPRFDYEEDAFQWRDRVASLLKGKNEN* |
| Ga0129333_100334506 | 3300010354 | Freshwater To Marine Saline Gradient | LIFIKGINMRLFCDDIQQIYVWVEDHDENIELSPHFDYEEDAIQWRDRMQELINKENSQ* |
| Ga0129333_100349085 | 3300010354 | Freshwater To Marine Saline Gradient | MKLICDDYNQVYVWVDDVDENLELSPHFDYEEDAVAWKERMKQELSK* |
| Ga0129333_100617733 | 3300010354 | Freshwater To Marine Saline Gradient | MKLFCDDLLQVYVWVEDHDENIELSPHFDYEEDAFQWRDRVKELLSKNNLGYKKL* |
| Ga0129333_101240167 | 3300010354 | Freshwater To Marine Saline Gradient | MRLLCDDYMQTYVWVEEYDENIELSPHFDYEEDAIQWRDRMEELLKQEKK* |
| Ga0129333_101290028 | 3300010354 | Freshwater To Marine Saline Gradient | MSTIQGNKMKLFCDDFQQIYVWVEDYDENIELSPHFDYEEDAIQWYERIKTLVEKNESVNE* |
| Ga0129333_102201723 | 3300010354 | Freshwater To Marine Saline Gradient | MRLICDDFQNVYVWVEDHDENIELSPHFDYEEDAIQWKLRIEQLLKEQHVSTN* |
| Ga0129333_115620712 | 3300010354 | Freshwater To Marine Saline Gradient | MQLICDDVNNIYVWVEDDDENMELSPHFDYEEDALLWKERMEQLLKE* |
| Ga0119955_11641861 | 3300012006 | Freshwater | MKLLYNDYQQIYVWVDDYNEDDELSPHFDYEEDAEQWYHRMKAEVNENKNG* |
| Ga0157140_100000145 | 3300012348 | Freshwater | MILICDDYNEVYVWVDDEDHDHELSPHFDYEEDAMAWKERMKNEVYK* |
| Ga0157210_10004467 | 3300012665 | Freshwater | MTLILDDYNQVYVWVEDDDHDHHLSPCFDYEEDAIQWKHRLRDLLQEKKK* |
| Ga0157210_10360692 | 3300012665 | Freshwater | MKLLADDYNEVYVWVDDEDENLQLSPSFDYEEDALQWRDRMKKELNG* |
| Ga0157210_10681413 | 3300012665 | Freshwater | AMKLIADDYNEIYVWVDDEDEDLQLSPSFDYEEDAIQWRDRMKRELNG* |
| Ga0157211_10148633 | 3300012933 | Freshwater | MILICDDYNEVYIWVDDEDHDHELSPHFDYEEDALKWRERIKKEVTK* |
| Ga0164293_108489741 | 3300013004 | Freshwater | MKLLSDEYNGIYVWVEDNDENIELSPHFDYEDDALLWRYRMMELHKKD* |
| Ga0164292_107299031 | 3300013005 | Freshwater | MKLLCDDYKEIYVWVDDLNEDLELSPHFDYEEDAVRWRDRMKQEL |
| Ga0163212_10756621 | 3300013087 | Freshwater | YNMRLICNDHDQVYVWVDDLDETIELSPHFDYEEDAIVWKKRNEDQTGQ* |
| Ga0136642_10009054 | 3300013285 | Freshwater | MKLLADEYNGIYVWVEELDENIELSPHFDYEEDAIKWRDTMRTKLV* |
| Ga0177922_101577722 | 3300013372 | Freshwater | MKLLLDDYNQVYVWVDDLNEDDHLSPCFDYEQDALQWANRIKTELNKMGNTQ* |
| Ga0181347_11986932 | 3300017722 | Freshwater Lake | MKLLLDDYNQVYVWVDDLNEDDHLSPCFDYEQDALQWANRIKTELNKMGNTQ |
| Ga0169931_100952763 | 3300017788 | Freshwater | MKRNGKGIKMKLLCDDIQGIYVWVEEHDENIELSPHFDYQEDAEQWRERVSKLLKDNKHE |
| Ga0207193_17261222 | 3300020048 | Freshwater Lake Sediment | MKLLCDDYKEIYVWVDDMNEDIELSPHFDYEEDAVRWRDRMKQELLREKK |
| Ga0194112_107634421 | 3300020109 | Freshwater Lake | NLEADCNMRLICNDHDQVYVWVDDLDETIELSPHFDYEEDAIVWRKRIEDKTGQ |
| Ga0211736_109098652 | 3300020151 | Freshwater | MKLLCDDYKEVYVWVDDLDEDHELSPHFDYEEDAIRWRDRMKQELLREKK |
| Ga0211733_102576503 | 3300020160 | Freshwater | MKLLLDDYNQVYVWVDDLNEDDHLSPCFDYEQDALQGAKRVKTELNKMGNTQ |
| Ga0211726_101833093 | 3300020161 | Freshwater | MKLLLDDYNQVYVWVDDLNEDDHLSPCFDYEQDALQWANRVKTELNKMGNTQ |
| Ga0211729_106807464 | 3300020172 | Freshwater | DDYKEVYVWVDDLDEDHELSPHFDYEEDAIRWRDRMKQELLREKK |
| Ga0194116_100020888 | 3300020204 | Freshwater Lake | MRLICNDHDQVYVWVDDLDETIELSPHFDYEEDAIVWRKRIEDKTGQ |
| Ga0194125_101928084 | 3300020222 | Freshwater Lake | MRLICNDHDQVYVWVDDLDETIELSPHFDYEEDAIVWRKR |
| Ga0194125_101987264 | 3300020222 | Freshwater Lake | NLEADYNMRLICNDHDQVYVWVDDLDETIELSPHFDYEEDAIVWRKRIEDQTGQ |
| Ga0208232_10235642 | 3300020527 | Freshwater | MKLLHDDYNLVYVWVDDDNEDIELSPHFDYEEDAVRWRNRMKQELLREKK |
| Ga0194133_1002025112 | 3300021091 | Freshwater Lake | MRLICNDHDQVYVWVDDLDETIELSPHFDYEEDAIVWRKRIEDQTG |
| Ga0222712_1000291821 | 3300021963 | Estuarine Water | MILICDDYNEVYVWVDDNDHDHELSPHFDYEEDAIAWKERIKQEVTK |
| Ga0222712_1000473217 | 3300021963 | Estuarine Water | MILICDDYNEVYVWVDDEDHDHELSPHFDYEEDALEWRERMKKEVYK |
| Ga0222712_100190956 | 3300021963 | Estuarine Water | MKLICDDYNQIYVWVEDLDENVELSPRFDYEEDAVIWKQRLEELLKVNK |
| Ga0222712_100270223 | 3300021963 | Estuarine Water | MTLICDDYNEVYVWVDDDDHDHELSPHFDYEEDAHAWKERMKQEVTK |
| Ga0222712_102581263 | 3300021963 | Estuarine Water | MILICDDYNEVYVWVDDEDHDHELSPHFDYEEDAHEWKERMKKEVYK |
| Ga0222712_103357753 | 3300021963 | Estuarine Water | MKLLADDYDEVYVWVDDYDEDIRLSPCFDYEEDAIQWRDRMRKELNE |
| Ga0222712_104553943 | 3300021963 | Estuarine Water | MILICDDYNEVYVWVDDDDHDHELSPHFDYEEDAIAWRERIKQEVTK |
| Ga0222712_107948712 | 3300021963 | Estuarine Water | MILICDDYNEVYVWVDDEDHDHELSPHFDYEEDAIAWRERIKKEVSK |
| Ga0196889_10372724 | 3300022072 | Aqueous | MKLLEDEFNGVYVWVEELDENIELSPHFDYEEDAIQWRDTMKAKLANFG |
| Ga0196905_11173531 | 3300022198 | Aqueous | DFQNVYVWVEDHDENIELSPHFDYEEDAIQWKLRIEQLLKEQYVSTN |
| Ga0196901_12448682 | 3300022200 | Aqueous | MRLICDDFQNVYVWVEDHDENIELSPHFDYEEDAIQWKLRIEQLLKEQHVSTN |
| Ga0228702_11351812 | 3300022748 | Freshwater | MKLLCDDYRQVYVWVDDLDEDDELSPCFDYEEDAIQWKERIKQEIVDK |
| Ga0244775_107644283 | 3300024346 | Estuarine | MILICDDYNEVYIWVDDEDHDHELSPHFDYEDDALEWRERIKKEVS |
| Ga0208383_10031835 | 3300025357 | Freshwater | MKLLCDDFNEVYIWVDDYDENIEFSPHFDYEEDALLWRERMKQELIK |
| Ga0208426_10275312 | 3300025451 | Aqueous | MKLFEDEFNGIYVWVDELDENIELSPHFDYEDDAIQWRDTMKSKLG |
| Ga0208426_10498671 | 3300025451 | Aqueous | KMILICDDYNEIYVWVDDNDHNHELSPHFDYEEDAHVWKERMKKEMLK |
| Ga0208546_10118273 | 3300025585 | Aqueous | MKLISDEFQGVYVWVDDENHDDELSPHFDYEEDAIQWKERIKQELYNKSE |
| Ga0208916_100072757 | 3300025896 | Aqueous | MQRLKMILICDDYNEIYVWVDDNDHNHELSPHFDYEEDAHVWKERMKKEMLK |
| Ga0209492_10915072 | 3300027721 | Freshwater Sediment | MKLICDDYNQIYVWVEDMDDNAELSPHFDYEEDALQWRNRVTELILKEKNAKS |
| Ga0209246_1000042814 | 3300027785 | Freshwater Lake | MILICDDYNEIYVWVDDNDHNHELSPHFDYEEDAHVWKERMKKEMLK |
| Ga0209229_100935375 | 3300027805 | Freshwater And Sediment | VKLLCDDYKQVYVWVNDLDEDDELSPRFDYEEDAILWKERLSAEILRESGFVPDDWK |
| Ga0209229_101125461 | 3300027805 | Freshwater And Sediment | MKLLADEWNQVYVWVDDFDENIELSPHFDYEEDALAWKERMKGELSK |
| Ga0209229_104713042 | 3300027805 | Freshwater And Sediment | MKMLYDDYNTVYMWVDDQDENIELSPRFDYVEDCEEWFHRMKKELNNDKH |
| Ga0209820_10284224 | 3300027956 | Freshwater Sediment | MKLLCDDHKEIYVWVDDMDEDVELSPHFDYEEDAVRWRDRMKQELLKEKK |
| Ga0119944_10096594 | 3300029930 | Aquatic | MRLICDDYDQVYVWVEDLDENIELSPRFDYEEDAVQWKHRLEELLKVNK |
| Ga0315907_103761002 | 3300031758 | Freshwater | MKLLCDDYKEIYVWVDDRNEDIELSPHFDYEEDAIRWRDRMKQELLRERK |
| Ga0315908_103159783 | 3300031786 | Freshwater | MTLILDDYNQVYVWVEDDDHDHHLSPCFDYEEDAIQWKHRLRDLLQEKKK |
| Ga0315909_100290039 | 3300031857 | Freshwater | MRLLHDDYNLVYVWVDDNDENEELSPHFDYEDDAFQWFERMKVEVTKNER |
| Ga0315909_102164983 | 3300031857 | Freshwater | MKLLCDDINQIYVWVDDSDENIELSPHFDYEEDAADWRERMKRELDDKGNY |
| Ga0334992_0000038_48960_49112 | 3300033992 | Freshwater | MKLLCDDYKEIYVWVDDLNEDLELSPHFDYEEDAVRWRDRMKQELLREKK |
| Ga0334987_0017178_5996_6139 | 3300034061 | Freshwater | MKLLADEWNQVYVWVDDYDEDKELSPRFDYEEDADQWYERMKQELLK |
| Ga0335000_0640212_153_296 | 3300034063 | Freshwater | MQLICDDVNNIYVWVEDDDENVELSPHFDYEEDALLWKERMEQLLKE |
| Ga0310130_0000959_16572_16715 | 3300034073 | Fracking Water | MRLICDDIQNVYVWVEDHDENIELSPHFDYEEDALIWKDRIEKLLKE |
| Ga0310130_0002434_5679_5822 | 3300034073 | Fracking Water | MHLICDDFQNVYVWVEDHDENIELSPHFDYEEDALQWKLRIEKLLKE |
| Ga0335020_0044716_281_433 | 3300034082 | Freshwater | MKLLCDDYKEIYVWVDDIDEDLELSPHFDYEEDAVRWRNRMKQELLREKK |
| Ga0335012_0000862_13754_13906 | 3300034093 | Freshwater | MKLLHDDYNLVYVWVDDDNEDIELSPHFDYEEDADQWFERMKKEVTKNER |
| Ga0335022_0575162_452_574 | 3300034095 | Freshwater | MKLLHDDYNLVYVWVDDDNEDIELSPHFDYEEDADQWFERM |
| Ga0335027_0253351_707_862 | 3300034101 | Freshwater | MRLFCDDIQQVYVWVEDHDENIELSPHFDYEEDAIQWRDRMQELINKENSR |
| Ga0335029_0000004_299131_299283 | 3300034102 | Freshwater | MKLLHDDYNLVYVWVDDMNEDIELSPHFDYEDDAFQWFERMKKEVTKNER |
| ⦗Top⦘ |