


| Basic Information | |
|---|---|
| Family ID | F087076 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTTLQAMCLGAMLAWTPSLVVLALLLREAPLDELERDPS |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 36.36 % |
| % of genes near scaffold ends (potentially truncated) | 63.64 % |
| % of genes from short scaffolds (< 2000 bps) | 81.82 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00816 | Histone_HNS | 6.36 |
| PF04679 | DNA_ligase_A_C | 2.73 |
| PF00891 | Methyltransf_2 | 0.91 |
| PF13458 | Peripla_BP_6 | 0.91 |
| PF04392 | ABC_sub_bind | 0.91 |
| PF05239 | PRC | 0.91 |
| PF01979 | Amidohydro_1 | 0.91 |
| PF08546 | ApbA_C | 0.91 |
| PF00440 | TetR_N | 0.91 |
| PF01609 | DDE_Tnp_1 | 0.91 |
| PF11154 | DUF2934 | 0.91 |
| PF00656 | Peptidase_C14 | 0.91 |
| PF13400 | Tad | 0.91 |
| PF00313 | CSD | 0.91 |
| PF01272 | GreA_GreB | 0.91 |
| PF01757 | Acyl_transf_3 | 0.91 |
| PF13437 | HlyD_3 | 0.91 |
| PF01527 | HTH_Tnp_1 | 0.91 |
| PF00106 | adh_short | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 6.36 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.73 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.91 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.91 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.91 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.91 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.91 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.91 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.91 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig48039 | Not Available | 691 | Open in IMG/M |
| 3300001305|C688J14111_10199952 | Not Available | 620 | Open in IMG/M |
| 3300001686|C688J18823_10278486 | Not Available | 1104 | Open in IMG/M |
| 3300002568|C688J35102_119348488 | Not Available | 678 | Open in IMG/M |
| 3300002568|C688J35102_120899698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2133 | Open in IMG/M |
| 3300005560|Ga0066670_10586388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 680 | Open in IMG/M |
| 3300005578|Ga0068854_100745638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 849 | Open in IMG/M |
| 3300005614|Ga0068856_100932128 | Not Available | 887 | Open in IMG/M |
| 3300005995|Ga0066790_10393295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 592 | Open in IMG/M |
| 3300006046|Ga0066652_100702221 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300006047|Ga0075024_100131587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1125 | Open in IMG/M |
| 3300006052|Ga0075029_100417519 | Not Available | 874 | Open in IMG/M |
| 3300006642|Ga0075521_10599086 | Not Available | 542 | Open in IMG/M |
| 3300006755|Ga0079222_10982982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
| 3300006797|Ga0066659_10759532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 798 | Open in IMG/M |
| 3300007255|Ga0099791_10658394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Muriiphilus → Muriiphilus fusiformis | 514 | Open in IMG/M |
| 3300007258|Ga0099793_10003549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5425 | Open in IMG/M |
| 3300007265|Ga0099794_10753029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300007788|Ga0099795_10226032 | Not Available | 798 | Open in IMG/M |
| 3300009137|Ga0066709_100695965 | Not Available | 1461 | Open in IMG/M |
| 3300009633|Ga0116129_1036934 | Not Available | 1580 | Open in IMG/M |
| 3300010039|Ga0126309_10052586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1953 | Open in IMG/M |
| 3300010040|Ga0126308_10228526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
| 3300010043|Ga0126380_12030874 | Not Available | 527 | Open in IMG/M |
| 3300010154|Ga0127503_10312577 | Not Available | 645 | Open in IMG/M |
| 3300010159|Ga0099796_10193178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Muriiphilus → Muriiphilus fusiformis | 822 | Open in IMG/M |
| 3300010856|Ga0126358_1065230 | Not Available | 534 | Open in IMG/M |
| 3300011120|Ga0150983_15506069 | Not Available | 1106 | Open in IMG/M |
| 3300012096|Ga0137389_10049129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3178 | Open in IMG/M |
| 3300012096|Ga0137389_11216078 | Not Available | 645 | Open in IMG/M |
| 3300012198|Ga0137364_10011451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5089 | Open in IMG/M |
| 3300012202|Ga0137363_10703654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300012202|Ga0137363_11770709 | Not Available | 510 | Open in IMG/M |
| 3300012203|Ga0137399_11479992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Muriiphilus → Muriiphilus fusiformis | 566 | Open in IMG/M |
| 3300012205|Ga0137362_10937685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 738 | Open in IMG/M |
| 3300012206|Ga0137380_10260010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1563 | Open in IMG/M |
| 3300012212|Ga0150985_103245527 | Not Available | 562 | Open in IMG/M |
| 3300012212|Ga0150985_109795313 | Not Available | 537 | Open in IMG/M |
| 3300012212|Ga0150985_110116517 | Not Available | 1510 | Open in IMG/M |
| 3300012362|Ga0137361_10045190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3602 | Open in IMG/M |
| 3300012363|Ga0137390_11808246 | Not Available | 542 | Open in IMG/M |
| 3300012582|Ga0137358_10022251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4095 | Open in IMG/M |
| 3300012685|Ga0137397_10030791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3819 | Open in IMG/M |
| 3300012685|Ga0137397_10366350 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300012929|Ga0137404_10061059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2924 | Open in IMG/M |
| 3300012944|Ga0137410_11876863 | Not Available | 530 | Open in IMG/M |
| 3300015052|Ga0137411_1181549 | Not Available | 1258 | Open in IMG/M |
| 3300015241|Ga0137418_10090390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2767 | Open in IMG/M |
| 3300015264|Ga0137403_10997384 | Not Available | 684 | Open in IMG/M |
| 3300015264|Ga0137403_11047614 | Not Available | 662 | Open in IMG/M |
| 3300015264|Ga0137403_11412545 | Not Available | 544 | Open in IMG/M |
| 3300018027|Ga0184605_10259948 | Not Available | 789 | Open in IMG/M |
| 3300018051|Ga0184620_10012304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1972 | Open in IMG/M |
| 3300018052|Ga0184638_1159682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300018071|Ga0184618_10163238 | Not Available | 917 | Open in IMG/M |
| 3300018071|Ga0184618_10192593 | Not Available | 850 | Open in IMG/M |
| 3300019789|Ga0137408_1008576 | Not Available | 966 | Open in IMG/M |
| 3300019877|Ga0193722_1082114 | Not Available | 790 | Open in IMG/M |
| 3300019879|Ga0193723_1055846 | Not Available | 1155 | Open in IMG/M |
| 3300019881|Ga0193707_1037947 | Not Available | 1564 | Open in IMG/M |
| 3300019881|Ga0193707_1090998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas | 923 | Open in IMG/M |
| 3300019883|Ga0193725_1005886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3538 | Open in IMG/M |
| 3300019883|Ga0193725_1051937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1046 | Open in IMG/M |
| 3300019883|Ga0193725_1144137 | Not Available | 519 | Open in IMG/M |
| 3300019886|Ga0193727_1027453 | Not Available | 1974 | Open in IMG/M |
| 3300019999|Ga0193718_1075207 | Not Available | 718 | Open in IMG/M |
| 3300020001|Ga0193731_1045048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1163 | Open in IMG/M |
| 3300020002|Ga0193730_1001767 | All Organisms → cellular organisms → Bacteria | 5865 | Open in IMG/M |
| 3300020002|Ga0193730_1013565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2324 | Open in IMG/M |
| 3300020022|Ga0193733_1175011 | Not Available | 566 | Open in IMG/M |
| 3300020062|Ga0193724_1109026 | Not Available | 555 | Open in IMG/M |
| 3300020170|Ga0179594_10291781 | Not Available | 617 | Open in IMG/M |
| 3300020199|Ga0179592_10399937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300021080|Ga0210382_10002027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6679 | Open in IMG/M |
| 3300021080|Ga0210382_10365784 | Not Available | 637 | Open in IMG/M |
| 3300021088|Ga0210404_10835670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 526 | Open in IMG/M |
| 3300021180|Ga0210396_10416558 | Not Available | 1180 | Open in IMG/M |
| 3300021344|Ga0193719_10125157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1116 | Open in IMG/M |
| 3300021363|Ga0193699_10333733 | Not Available | 632 | Open in IMG/M |
| 3300022756|Ga0222622_10308698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1091 | Open in IMG/M |
| 3300025463|Ga0208193_1083246 | Not Available | 638 | Open in IMG/M |
| 3300026285|Ga0209438_1000360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 13610 | Open in IMG/M |
| 3300026285|Ga0209438_1170894 | Not Available | 572 | Open in IMG/M |
| 3300026304|Ga0209240_1271927 | Not Available | 521 | Open in IMG/M |
| 3300026340|Ga0257162_1001975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2257 | Open in IMG/M |
| 3300026358|Ga0257166_1003514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1682 | Open in IMG/M |
| 3300026361|Ga0257176_1004280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1590 | Open in IMG/M |
| 3300026489|Ga0257160_1002865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1938 | Open in IMG/M |
| 3300026489|Ga0257160_1012694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1236 | Open in IMG/M |
| 3300026497|Ga0257164_1050510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Muriiphilus → Muriiphilus fusiformis | 666 | Open in IMG/M |
| 3300027512|Ga0209179_1103863 | Not Available | 633 | Open in IMG/M |
| 3300027535|Ga0209734_1058825 | Not Available | 728 | Open in IMG/M |
| 3300027663|Ga0208990_1003795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4874 | Open in IMG/M |
| 3300027671|Ga0209588_1154745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300027862|Ga0209701_10199850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Muriiphilus → Muriiphilus fusiformis | 1192 | Open in IMG/M |
| 3300027910|Ga0209583_10006691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3302 | Open in IMG/M |
| 3300027910|Ga0209583_10012214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2565 | Open in IMG/M |
| 3300027915|Ga0209069_10030576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2520 | Open in IMG/M |
| 3300028047|Ga0209526_10403503 | Not Available | 907 | Open in IMG/M |
| 3300028536|Ga0137415_10045443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4280 | Open in IMG/M |
| 3300028793|Ga0307299_10274568 | Not Available | 633 | Open in IMG/M |
| 3300028814|Ga0307302_10180685 | Not Available | 1027 | Open in IMG/M |
| 3300028819|Ga0307296_10173019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1170 | Open in IMG/M |
| 3300028828|Ga0307312_10203332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1272 | Open in IMG/M |
| 3300028828|Ga0307312_10548546 | Not Available | 764 | Open in IMG/M |
| 3300030830|Ga0308205_1053348 | Not Available | 543 | Open in IMG/M |
| 3300030904|Ga0308198_1086161 | Not Available | 535 | Open in IMG/M |
| 3300030993|Ga0308190_1186679 | Not Available | 515 | Open in IMG/M |
| 3300031057|Ga0170834_113783029 | Not Available | 534 | Open in IMG/M |
| 3300032515|Ga0348332_12252883 | Not Available | 890 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.27% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.73% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.73% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.82% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_01105810 | 2140918007 | Soil | KDNPRPQAKEGGVMTTLQAMCLGAMLAWTPSLVVLALLLRAAPVDDLEGAPS |
| C688J14111_101999521 | 3300001305 | Soil | VGSFGMGGDASMTTLQAMCLGAMLAWTPSLIVLAWLLREAPLDEL* |
| C688J18823_102784863 | 3300001686 | Soil | MTTLQAICLGAMLAWTPSLVVLAWLLREAPLDEL* |
| C688J35102_1193484882 | 3300002568 | Soil | RFYLVRSVRMGGGATMTTLQAICLGAMLAWTPSLVLLAWLLRDAPLDEL* |
| C688J35102_1208996984 | 3300002568 | Soil | LWLRLLRGEGAAVTTLQAICLGAMLAWTPSVVVLAWLLREAPLDELDELQRDPS* |
| Ga0066670_105863882 | 3300005560 | Soil | MTTLQAICLGAMLAWTPTLLVLAWLLREVPRDEL* |
| Ga0068854_1007456382 | 3300005578 | Corn Rhizosphere | MTTLQAICLGAMLAWTPSLLVLAWLLREGPVDDF* |
| Ga0068856_1009321283 | 3300005614 | Corn Rhizosphere | MGGGATMTTLQAICLGAMLAWTPSLVLLAWLLRDAPLLDEL* |
| Ga0066790_103932952 | 3300005995 | Soil | MTTLQAIGFGAMLAWTPSLIVMALVLCETPLDVMDE |
| Ga0066652_1007022212 | 3300006046 | Soil | IMTTLQAICLGAMLAWTPSLIVLAWLLREAPLDEF* |
| Ga0075024_1001315872 | 3300006047 | Watersheds | MTTLQAMCLGAMLAWTPSLVVLALLLREAPLDELQHDPL* |
| Ga0075029_1004175191 | 3300006052 | Watersheds | MTTLQAVGLGAMLAWTPSLFVLAWMLYDAPLDEHQRDRS* |
| Ga0075521_105990862 | 3300006642 | Arctic Peat Soil | MGTANMTTLQAICYGTMLAWTPSLIVMALVLWETPLDVLD* |
| Ga0079222_109829822 | 3300006755 | Agricultural Soil | MTTLEAMWLGEMLAWTPSLVVLAWLLREGPVDDF* |
| Ga0066659_107595321 | 3300006797 | Soil | GGVMTTLQAMCFGAMLAWTPSLLVLALLLREDSLDEFQHDPS* |
| Ga0099791_106583942 | 3300007255 | Vadose Zone Soil | TTLQAMCLGAMLAWTLSLVVLASLLREPPQLDELERDPS* |
| Ga0099793_100035498 | 3300007258 | Vadose Zone Soil | MTTLQAMCLGAMLAWTLSLVVLASLLREPPLDELERDPS* |
| Ga0099794_107530291 | 3300007265 | Vadose Zone Soil | MGWETQGGVMTTLQAICLGAMLAWTPSLVVLALLLGEVPPDEIQREPS* |
| Ga0099795_102260322 | 3300007788 | Vadose Zone Soil | MTTLQAICLGAMLAWTPSLVVLAALLLREAPLEELERDPS* |
| Ga0066709_1006959653 | 3300009137 | Grasslands Soil | MMTVQAICLGAMLAWTPSLVVLALLLIKIPPDELAEL* |
| Ga0116129_10369344 | 3300009633 | Peatland | LTVDVMTTLQAICFGAMIAWTPSLVVMAWVLYEAPLDELDEFERDPS* |
| Ga0126309_100525862 | 3300010039 | Serpentine Soil | MTTLQAICLGAMLAWTPSLVVLAWLLREAPVDEF* |
| Ga0126308_102285261 | 3300010040 | Serpentine Soil | MTTLQAIWLGAMLAWTPSLVVLAWLLREAPVDELQ |
| Ga0126380_120308742 | 3300010043 | Tropical Forest Soil | MSTLQAMCFGAMLAWTPGMIVLAVLLWREPRALDEV |
| Ga0127503_103125771 | 3300010154 | Soil | GGVMTTLQAMCFGAMLAWTPSLVVLALLLREVPLDEPDELQRSQS* |
| Ga0099796_101931783 | 3300010159 | Vadose Zone Soil | VNRCFRSLETQGGVMTTLQAMCLGAMLAWTLSLVVLASLLREPPLDELERDPS* |
| Ga0126358_10652302 | 3300010856 | Boreal Forest Soil | GIMTTLQAICLGAMLAWTPSLVVLALLLRETPLDEVARVPS* |
| Ga0150983_155060693 | 3300011120 | Forest Soil | MRVNVMTTLQAICFGAMLAWTPSLIVVSWLLRHAPLDEETPLDEFEELERDPS* |
| Ga0137389_100491297 | 3300012096 | Vadose Zone Soil | MNRCFRSMESQGGVVTTLQAMCLGAMLAWTPSLVVLALLLRAAPVDDLEGDPSKA* |
| Ga0137389_112160781 | 3300012096 | Vadose Zone Soil | MTTLQAVCLGAMLAWTPSLVVLALLLREAPLDELQRGP |
| Ga0137364_100114512 | 3300012198 | Vadose Zone Soil | MTTLQAVCLGAMLAWTPSLVVLALLLREPALDELQRDPS* |
| Ga0137363_107036542 | 3300012202 | Vadose Zone Soil | MGWETQGGVMTTLQAICLGAMLAWTPSLVVLALLLGEVPLDEIQREAS* |
| Ga0137363_117707091 | 3300012202 | Vadose Zone Soil | PESQGGVMTTLQAICLGAMLAWTPSLVVLALLLREPALDELQRDPS* |
| Ga0137399_114799922 | 3300012203 | Vadose Zone Soil | VNRCFRSLETQGGVMTTLQAMCLGAMLAWTLSLVVLASLLREPPQLDELERDPS* |
| Ga0137362_109376851 | 3300012205 | Vadose Zone Soil | ALFKGGETQGGVMTTLQAMCLGAMLAWTPSLVVLALLLHEAPLDELQHDPS* |
| Ga0137380_102600101 | 3300012206 | Vadose Zone Soil | QGDVMTTLQAICLGAMLSWTPSLVVLAALLLREAPLEELERDPS* |
| Ga0150985_1032455272 | 3300012212 | Avena Fatua Rhizosphere | GATMTTLQAICLGAMLAWTPSLVLLAWLLRDAPLDEL* |
| Ga0150985_1097953133 | 3300012212 | Avena Fatua Rhizosphere | ATMTTLQAICLGAMLAWTPSLVLLAWLLRDAPLDEL* |
| Ga0150985_1101165172 | 3300012212 | Avena Fatua Rhizosphere | SKGALMTILEAMWLGAMLAWTPSLVVLAWLLRENPLDDL* |
| Ga0137361_100451901 | 3300012362 | Vadose Zone Soil | MNRCFRSMESQGGVVTTLQAMCLGAMLAWTSSLVVLALLLRAAPVDDLEGDPS* |
| Ga0137390_118082462 | 3300012363 | Vadose Zone Soil | MTTLQAICFEAMLARTPSLVVLAWLLREAPLDEL* |
| Ga0137358_100222511 | 3300012582 | Vadose Zone Soil | ICQLNALLKGWETQGDVMTTLQAICLGAMLAWTPSLVVLAALLLREAPLDELERDPS* |
| Ga0137397_100307919 | 3300012685 | Vadose Zone Soil | MTTLRAICLGAMLAWTPSLVVLALLLGEVPLDEIQREPS* |
| Ga0137397_103663502 | 3300012685 | Vadose Zone Soil | MTTLQAMCLGAMLAWTLSLVVLASLLREPPLDELE |
| Ga0137404_100610592 | 3300012929 | Vadose Zone Soil | MTTLQAMCLGAMLAWTPSLVVLALLLREAPLDELERDPS* |
| Ga0137410_118768632 | 3300012944 | Vadose Zone Soil | GGETQGGVMTTLQAMCLGAMLAWTPSLVVLALLLREAQLDELQHDPS* |
| Ga0137411_11815491 | 3300015052 | Vadose Zone Soil | MYQLNALFKGWETQGDVMTTLQAVCLGAMLAWTPSFVVLALLLREAPLDELERDPS* |
| Ga0137418_100903902 | 3300015241 | Vadose Zone Soil | MTTLQAICLGAMLAWTPSLVVLALLLREPALDELQRDPS* |
| Ga0137403_109973841 | 3300015264 | Vadose Zone Soil | ETQGDVMTTLQAICLGAMLAWTPSLVVLAALLLREAPLEELERDPS* |
| Ga0137403_110476141 | 3300015264 | Vadose Zone Soil | LNALLKGWETQGGVMTTLQAICLGAMLAWTPSLVVLAALLLREAPLEKLERDPS* |
| Ga0137403_114125451 | 3300015264 | Vadose Zone Soil | MGWETQGGVMTTLQAICFGAMLAWTPSLVVLALLLGEAPLDELQRDPS* |
| Ga0184605_102599481 | 3300018027 | Groundwater Sediment | LQAVCLGAMLSWTPSLVVLAALLLREAPLEELERDPS |
| Ga0184620_100123043 | 3300018051 | Groundwater Sediment | MTTLQAMCLGAMLAWTPSLVVLALLLRETPLDELERDPS |
| Ga0184638_11596821 | 3300018052 | Groundwater Sediment | QAMCLGAMLAWTPSLVVLALLLREAPLDEIEREPS |
| Ga0184618_101632381 | 3300018071 | Groundwater Sediment | MTTLQAICLGAMLAWTPSLVVLALLLREPALDELQRD |
| Ga0184618_101925931 | 3300018071 | Groundwater Sediment | QGGVMTTLQAICLGAMLAWTPSLVVLALLLRAAPVDDLEGDPSTA |
| Ga0137408_10085763 | 3300019789 | Vadose Zone Soil | LNALLKDWEIQGGVMTTLQAICLGAMLAWTPSLVVLASLLLRETPLEELERDPS |
| Ga0193722_10821142 | 3300019877 | Soil | LLKGRETQGDVMTTLQAICLGAMLSWTPSLVVLAALLLREAPLEELE |
| Ga0193723_10558461 | 3300019879 | Soil | CFRSLVSQGGVMTTLQAMCLGAMLAWTPSLVVLALLLRAAPVDDLEGDPS |
| Ga0193707_10379471 | 3300019881 | Soil | QAMCLGAMLAWTPTLVVLALLLREAPLEELERDPS |
| Ga0193707_10909981 | 3300019881 | Soil | TCPLRVETQGGVMTTLQAMCLGAMLAWTPSLVVLALLLRESPLDEVERDPS |
| Ga0193725_10058866 | 3300019883 | Soil | MTTLQAMCLGAMLAWTPSLVVLALLLRAAPVDDLEGDPS |
| Ga0193725_10519371 | 3300019883 | Soil | GRETQGGVMTTLQAICFGAMLAWTPSLVVLALLLCEAPLDELQRDPS |
| Ga0193725_11441371 | 3300019883 | Soil | MTTLQAICLGAMLAWTPSLVVLALLLREPALDELQRDPS |
| Ga0193727_10274533 | 3300019886 | Soil | MGWETQGGVMTTLQAICLGAMLAWTPSLVVLALLLGEVPLDEIQREPS |
| Ga0193718_10752071 | 3300019999 | Soil | EGGVMTTLQAMCLGAMLAWTPSLVVLALLLRAAPVDDLEGDPS |
| Ga0193731_10450483 | 3300020001 | Soil | GGVMTTLQAMCLGAMLAWTPSLVVLALLLRAAPVDDLEGDPS |
| Ga0193730_10017678 | 3300020002 | Soil | MTTLQAMCLGAMLAWTPSLVVLALLLRAAPVDDLEGDPF |
| Ga0193730_10135651 | 3300020002 | Soil | MTTLQAMCLGAMLAWTPSLVVLVWLLREAPLDELQHDPS |
| Ga0193733_11750111 | 3300020022 | Soil | KRGVMTTLQAMCLGAMLAWTPSLVVLALLLRAAPVDDLEGDPF |
| Ga0193724_11090261 | 3300020062 | Soil | GGRETQGGVMTTLQAICFGAMLAWTPSLVVLALLLCEAPLDELQRDPS |
| Ga0179594_102917811 | 3300020170 | Vadose Zone Soil | CSRAGETQGDVMTTLQAMCLGAMLAWTPSLVVLAALLLREAPLEELERDPS |
| Ga0179592_103999372 | 3300020199 | Vadose Zone Soil | WETQGGVMTTLRAICLGAMLAWTPSLVVLALLLGDVPLDEIQREPS |
| Ga0210382_100020275 | 3300021080 | Groundwater Sediment | MTTLQAMCLGAMLAWTPSRVVLVWLLREAPLDELQHDPS |
| Ga0210382_103657842 | 3300021080 | Groundwater Sediment | LNALLKGWETQGDVMTTLQAICLGAMLAWTPSLVVLAALLL |
| Ga0210404_108356701 | 3300021088 | Soil | MTTLQAICLGAMLAWTPSLIVLALLLRYVPLDELD |
| Ga0210396_104165582 | 3300021180 | Soil | MTTIQAICFGAMLAWTPSLVVLALLLRAAPLEEDLAG |
| Ga0193719_101251573 | 3300021344 | Soil | GVMTTLQAMCLGAMLAWTPSRVVLVWLLREAPLDELQHDPS |
| Ga0193699_103337331 | 3300021363 | Soil | ASYGVNRCFRSLETQGGVMTTLQAMCLGAMLAWTPSLVVLALLLRESPLDEVERDPS |
| Ga0222622_103086981 | 3300022756 | Groundwater Sediment | MTTLQAMCLGAMLAWTPSLVVLALLFREAPLDELE |
| Ga0208193_10832461 | 3300025463 | Peatland | LTVDVMTTLQAICFGAMIAWTPSLVVMAWVLYEAPLDELDEFERDPS |
| Ga0209438_10003607 | 3300026285 | Grasslands Soil | MYQLNALFKGWETQGDVMTTLQAVCLGAMLAWTPSFVVLALLLREAPLDELERDPS |
| Ga0209438_11708941 | 3300026285 | Grasslands Soil | GPESQGGVMTTLQAICLGAMLAWTPSLVVLALLLREPALDELQRDPS |
| Ga0209240_12719272 | 3300026304 | Grasslands Soil | MYQLNALFKGWETQGDVMTTLQAVCLGAMLAWTPSLVVLALLLREAPLDELERDPS |
| Ga0257162_10019757 | 3300026340 | Soil | IYELNALFKGGETQGGVMTTLQAMCLGAMLAWTPSLVVLALLLHEAPLDELQHDPS |
| Ga0257166_10035141 | 3300026358 | Soil | ETQGGVMTTLQAMCLGAMLAWTPSLVVLALLLHEAPLDELQHDPS |
| Ga0257176_10042801 | 3300026361 | Soil | ELNALFKGGETQGGVMTTLQAMCLGAMLAWTPSLVVLALLLREAPLDELQHDPS |
| Ga0257160_10028655 | 3300026489 | Soil | RSLETQGGVMTTLQAMCLGAMLAWTLSLVVLASLLREPPLDELERDPS |
| Ga0257160_10126943 | 3300026489 | Soil | GVMTTLQAMCLGAMLAWTPSLVVLALLLHEAPLDELQHDPS |
| Ga0257164_10505101 | 3300026497 | Soil | CFRSLETQGGVMTTLQAMCLGAMLAWTLSLVVLASLLREPPLDELERDPS |
| Ga0209179_11038631 | 3300027512 | Vadose Zone Soil | MTTLQAICLGAMLAWTPSLVVLAALLLREAPLEELERDPS |
| Ga0209734_10588252 | 3300027535 | Forest Soil | QGDVMTTLQAVCLGAMLAWTPSLVVLALLLREAPLDELERDPS |
| Ga0208990_10037951 | 3300027663 | Forest Soil | VMTTLQAVCLGAMLAWTPSLVVLALLLREAPLDELERDPS |
| Ga0209588_11547451 | 3300027671 | Vadose Zone Soil | MGWETQGGVMTTLQAICLGAMLAWTPSLVVLALLLGEVPPDEIQREPS |
| Ga0209701_101998501 | 3300027862 | Vadose Zone Soil | YQLNALLKGWETQGDVMTTLQAVCLGAMLAWTPSLVVLALLLREAPLDELERDPS |
| Ga0209583_100066913 | 3300027910 | Watersheds | MTTLQAMCLGAMLAWTPSLVVLALLLRETPLDELERHPS |
| Ga0209583_100122143 | 3300027910 | Watersheds | MTTLQAMCLGAMLAWTPSLAVLAWLLREAPLDELQHDPS |
| Ga0209069_100305765 | 3300027915 | Watersheds | MTTLQAMCLGAMLAWTPSLVVLALLLREAPLDELQHDPL |
| Ga0209526_104035032 | 3300028047 | Forest Soil | MTTLQAIWLGAMLAWTPSLVVLALLLREPPLDELDPFSRKPPVT |
| Ga0137415_100454436 | 3300028536 | Vadose Zone Soil | MTTLQAVCLGAMLAWTPSLVVLALLLREPALDELQRDPS |
| Ga0307299_102745681 | 3300028793 | Soil | DVMTTLQAICLGAMLSWTPSLVVLAALLLREAPLEELERDPS |
| Ga0307302_101806852 | 3300028814 | Soil | LNALLKGWETQGDVMTTLQAICLGAMLAWTPSLVVLAALLLREAPLEELERDPS |
| Ga0307296_101730193 | 3300028819 | Soil | RCFRGLESQGGVMTTLQAMCLGAMLAWTPSLVVLVWLLREAPLDELQHDPS |
| Ga0307312_102033322 | 3300028828 | Soil | LKGRETQGDVMTTLQAICLGAMLSWTPSLVVLAALLLREAPLEELERDPS |
| Ga0307312_105485461 | 3300028828 | Soil | MTTLQAICLGAMLSWTPSLVVLAALLLREAPLEELE |
| Ga0308205_10533481 | 3300030830 | Soil | PESQGGIMTTLQAICLGALLAWTPSLVVFALLLREPALDELQRDPS |
| Ga0308198_10861611 | 3300030904 | Soil | QGDVMTTLQAMCLGAMLAWAPSLVVLALLLREAPLDELQHDPS |
| Ga0308190_11866791 | 3300030993 | Soil | SFTSGPESQGGIMTTLQAICLGALLAWTPSLVVFALLLREPALDELQRDPS |
| Ga0170834_1137830291 | 3300031057 | Forest Soil | VAEGGDTQGGVMTTLQAICLGAMLAWAPSLIVLAFLLRKVPLDELDELQRDPS |
| Ga0348332_122528834 | 3300032515 | Plant Litter | RVNVMTTLQAICFGAMLAWTPSLIVVSWLLRHAPLDEETPLDEFEELESDPS |
| ⦗Top⦘ |