


| Basic Information | |
|---|---|
| Family ID | F087015 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLV |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.36 % |
| % of genes near scaffold ends (potentially truncated) | 96.36 % |
| % of genes from short scaffolds (< 2000 bps) | 74.55 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (36.364 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (63.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 75.61% β-sheet: 0.00% Coil/Unstructured: 24.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF16778 | Phage_tail_APC | 33.64 |
| PF13884 | Peptidase_S74 | 10.91 |
| PF13385 | Laminin_G_3 | 5.45 |
| PF10282 | Lactonase | 0.91 |
| PF12236 | Head-tail_con | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.73 % |
| Unclassified | root | N/A | 36.36 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10114050 | Not Available | 959 | Open in IMG/M |
| 3300001957|GOS2250_1011181 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300005512|Ga0074648_1094911 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300006025|Ga0075474_10096380 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 958 | Open in IMG/M |
| 3300006027|Ga0075462_10006357 | All Organisms → cellular organisms → Bacteria | 3831 | Open in IMG/M |
| 3300006027|Ga0075462_10007841 | All Organisms → Viruses | 3465 | Open in IMG/M |
| 3300006752|Ga0098048_1013735 | All Organisms → Viruses → Predicted Viral | 2803 | Open in IMG/M |
| 3300006790|Ga0098074_1160287 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 574 | Open in IMG/M |
| 3300006802|Ga0070749_10157732 | Not Available | 1317 | Open in IMG/M |
| 3300006802|Ga0070749_10499493 | Not Available | 663 | Open in IMG/M |
| 3300006802|Ga0070749_10592984 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 598 | Open in IMG/M |
| 3300006810|Ga0070754_10229439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300006810|Ga0070754_10346460 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 658 | Open in IMG/M |
| 3300006810|Ga0070754_10423163 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 580 | Open in IMG/M |
| 3300006868|Ga0075481_10160132 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300006868|Ga0075481_10270191 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 596 | Open in IMG/M |
| 3300006869|Ga0075477_10320074 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 613 | Open in IMG/M |
| 3300006869|Ga0075477_10327922 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 604 | Open in IMG/M |
| 3300006870|Ga0075479_10098388 | Not Available | 1215 | Open in IMG/M |
| 3300006874|Ga0075475_10011710 | All Organisms → Viruses → Predicted Viral | 4412 | Open in IMG/M |
| 3300006916|Ga0070750_10432868 | Not Available | 546 | Open in IMG/M |
| 3300006919|Ga0070746_10522255 | Not Available | 518 | Open in IMG/M |
| 3300006920|Ga0070748_1219211 | Not Available | 691 | Open in IMG/M |
| 3300007276|Ga0070747_1102960 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300007344|Ga0070745_1057662 | Not Available | 1583 | Open in IMG/M |
| 3300007345|Ga0070752_1011937 | Not Available | 4624 | Open in IMG/M |
| 3300007345|Ga0070752_1024839 | Not Available | 2982 | Open in IMG/M |
| 3300007346|Ga0070753_1043821 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1866 | Open in IMG/M |
| 3300007346|Ga0070753_1207755 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 722 | Open in IMG/M |
| 3300007346|Ga0070753_1208036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 722 | Open in IMG/M |
| 3300007346|Ga0070753_1309170 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 563 | Open in IMG/M |
| 3300007346|Ga0070753_1371767 | Not Available | 501 | Open in IMG/M |
| 3300007363|Ga0075458_10247855 | Not Available | 543 | Open in IMG/M |
| 3300007539|Ga0099849_1291929 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 590 | Open in IMG/M |
| 3300007640|Ga0070751_1317401 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 578 | Open in IMG/M |
| 3300009071|Ga0115566_10666923 | Not Available | 578 | Open in IMG/M |
| 3300009124|Ga0118687_10141316 | Not Available | 855 | Open in IMG/M |
| 3300009433|Ga0115545_1212690 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 657 | Open in IMG/M |
| 3300010299|Ga0129342_1324343 | Not Available | 527 | Open in IMG/M |
| 3300010300|Ga0129351_1366059 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 540 | Open in IMG/M |
| 3300010318|Ga0136656_1284213 | Not Available | 540 | Open in IMG/M |
| 3300012920|Ga0160423_10066558 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
| 3300012920|Ga0160423_10607480 | Not Available | 741 | Open in IMG/M |
| 3300016737|Ga0182047_1573384 | Not Available | 706 | Open in IMG/M |
| 3300017709|Ga0181387_1083736 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 646 | Open in IMG/M |
| 3300017756|Ga0181382_1123426 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 688 | Open in IMG/M |
| 3300017781|Ga0181423_1000090 | Not Available | 38455 | Open in IMG/M |
| 3300017951|Ga0181577_10104989 | All Organisms → Viruses → Predicted Viral | 1954 | Open in IMG/M |
| 3300017951|Ga0181577_10148105 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300017951|Ga0181577_10204966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300017985|Ga0181576_10134174 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300017985|Ga0181576_10900994 | Not Available | 518 | Open in IMG/M |
| 3300018417|Ga0181558_10244838 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300018421|Ga0181592_10176929 | unclassified Hyphomonas → Hyphomonas sp. | 1610 | Open in IMG/M |
| 3300019765|Ga0194024_1017322 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1526 | Open in IMG/M |
| 3300019765|Ga0194024_1136233 | Not Available | 572 | Open in IMG/M |
| 3300020056|Ga0181574_10334025 | Not Available | 908 | Open in IMG/M |
| 3300020417|Ga0211528_10060503 | Not Available | 1615 | Open in IMG/M |
| 3300020442|Ga0211559_10013321 | All Organisms → Viruses → Predicted Viral | 4222 | Open in IMG/M |
| 3300021356|Ga0213858_10420934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300021371|Ga0213863_10392771 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 562 | Open in IMG/M |
| 3300021425|Ga0213866_10378734 | Not Available | 694 | Open in IMG/M |
| 3300021957|Ga0222717_10025948 | All Organisms → cellular organisms → Bacteria | 3894 | Open in IMG/M |
| 3300021958|Ga0222718_10081393 | All Organisms → Viruses → Predicted Viral | 1952 | Open in IMG/M |
| 3300021959|Ga0222716_10455322 | Not Available | 730 | Open in IMG/M |
| 3300022065|Ga0212024_1018545 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300022065|Ga0212024_1054417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 704 | Open in IMG/M |
| 3300022069|Ga0212026_1021436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300022071|Ga0212028_1026322 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300022158|Ga0196897_1038265 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 573 | Open in IMG/M |
| 3300022159|Ga0196893_1019300 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 625 | Open in IMG/M |
| 3300022176|Ga0212031_1052472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300022183|Ga0196891_1003077 | All Organisms → Viruses | 3562 | Open in IMG/M |
| 3300022187|Ga0196899_1131253 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 712 | Open in IMG/M |
| 3300022187|Ga0196899_1214141 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 505 | Open in IMG/M |
| 3300023117|Ga0255757_10053359 | All Organisms → Viruses → Predicted Viral | 2692 | Open in IMG/M |
| 3300025093|Ga0208794_1006308 | All Organisms → Viruses → Predicted Viral | 3388 | Open in IMG/M |
| 3300025128|Ga0208919_1246745 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 519 | Open in IMG/M |
| 3300025610|Ga0208149_1044587 | Not Available | 1165 | Open in IMG/M |
| 3300025610|Ga0208149_1142633 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 551 | Open in IMG/M |
| 3300025630|Ga0208004_1075098 | Not Available | 849 | Open in IMG/M |
| 3300025653|Ga0208428_1032662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1654 | Open in IMG/M |
| 3300025653|Ga0208428_1167930 | Not Available | 578 | Open in IMG/M |
| 3300025655|Ga0208795_1010339 | All Organisms → Viruses → Predicted Viral | 3333 | Open in IMG/M |
| 3300025671|Ga0208898_1033892 | Not Available | 2045 | Open in IMG/M |
| 3300025671|Ga0208898_1128378 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 719 | Open in IMG/M |
| 3300025671|Ga0208898_1143155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300025674|Ga0208162_1005356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5941 | Open in IMG/M |
| 3300025687|Ga0208019_1179947 | Not Available | 570 | Open in IMG/M |
| 3300025751|Ga0208150_1044602 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300025751|Ga0208150_1174781 | Not Available | 672 | Open in IMG/M |
| 3300025759|Ga0208899_1017145 | All Organisms → Viruses | 3739 | Open in IMG/M |
| 3300025759|Ga0208899_1036648 | All Organisms → Viruses → Predicted Viral | 2235 | Open in IMG/M |
| 3300025769|Ga0208767_1054296 | All Organisms → Viruses → Predicted Viral | 1846 | Open in IMG/M |
| 3300025769|Ga0208767_1087079 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1293 | Open in IMG/M |
| 3300025803|Ga0208425_1038069 | Not Available | 1227 | Open in IMG/M |
| 3300025818|Ga0208542_1000581 | Not Available | 16656 | Open in IMG/M |
| 3300025818|Ga0208542_1002325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7638 | Open in IMG/M |
| 3300025818|Ga0208542_1027853 | All Organisms → Viruses → Predicted Viral | 1860 | Open in IMG/M |
| 3300025828|Ga0208547_1020418 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2687 | Open in IMG/M |
| 3300025853|Ga0208645_1033178 | Not Available | 2652 | Open in IMG/M |
| 3300025853|Ga0208645_1240693 | Not Available | 610 | Open in IMG/M |
| 3300034374|Ga0348335_035382 | All Organisms → Viruses → Predicted Viral | 2123 | Open in IMG/M |
| 3300034375|Ga0348336_050791 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
| 3300034375|Ga0348336_204507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300034418|Ga0348337_005538 | Not Available | 8265 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 63.64% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.09% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.64% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.64% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.64% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.73% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.73% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.82% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.82% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.82% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.91% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.91% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001957 | Marine microbial communities from Wolf Island, Equador - GS035 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023117 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG | Environmental | Open in IMG/M |
| 3300025093 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_101140503 | 3300000117 | Marine | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGAW |
| GOS2250_10111811 | 3300001957 | Marine | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAKKLGHWYTLV |
| Ga0074648_10949111 | 3300005512 | Saline Water And Sediment | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGQWYS |
| Ga0075474_100963801 | 3300006025 | Aqueous | MDPVSLVAMASTAFKGVQVLVSKGAEIEHVAQKLGQWYG |
| Ga0075462_100063577 | 3300006027 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHWYGL |
| Ga0075462_100078411 | 3300006027 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHWYGLVADI |
| Ga0098048_10137354 | 3300006752 | Marine | MDPLSLVAMASTAFKGVEVLVSRGAELEHVAKKLGQWYGFVSD |
| Ga0098074_11602872 | 3300006790 | Marine | VDPVSLVAIASSTFKGIQVLVSKGAEIEHVAQKLGHW |
| Ga0070749_101577323 | 3300006802 | Aqueous | MASTTFKGLQVLVSKGAEIERVAQKLGHWYTLVSD |
| Ga0070749_104994931 | 3300006802 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSDI |
| Ga0070749_105929842 | 3300006802 | Aqueous | MDPLSLVAMASTAFKGIEVLVSRGAEIEQVAQKLGHWY |
| Ga0070754_102294392 | 3300006810 | Aqueous | VDPLSLVAMASTAFKGIEVLVSRGAEIEHVAQKLGHWY |
| Ga0070754_103464602 | 3300006810 | Aqueous | VDPLSLVAMASTAFKGVEILVSRGAEIEHVAQKLGHWY |
| Ga0070754_104231631 | 3300006810 | Aqueous | MDPLSLVAMASTTFKGLQILVSKGAEIEHVAQKLGHWYGLV |
| Ga0075476_101317353 | 3300006867 | Aqueous | MDPVSLVAMASTTFKGVQILVSKGAEIEHVAQKLGHWYGLVSDIKEAE |
| Ga0075481_101601323 | 3300006868 | Aqueous | MDPLSLVALASSSFKGVQILVSKGAEIEHVAQKLGHWYGLVS |
| Ga0075481_102701912 | 3300006868 | Aqueous | MDPLSLVAMASTAFKGIEVLVSRGAEIEHVAQKLGHWYGF |
| Ga0075477_103200742 | 3300006869 | Aqueous | MDPVSLVAMASTAFKGIEVLVSRGAEIEQVAQKLGHWYGLV |
| Ga0075477_103279221 | 3300006869 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVS |
| Ga0075479_100983882 | 3300006870 | Aqueous | VDPLSLVAMASTAFKGIEVLVSRGAEIEQVAQKLGHW |
| Ga0075475_100117102 | 3300006874 | Aqueous | VDPLSLVAMASTAFKGIEVLVSRGAEIEQVAQKLGHWYSF |
| Ga0070750_104328681 | 3300006916 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLV |
| Ga0070746_105222553 | 3300006919 | Aqueous | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGAWYS |
| Ga0070748_12192113 | 3300006920 | Aqueous | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGAWY |
| Ga0070747_11029601 | 3300007276 | Aqueous | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGA |
| Ga0070745_10576624 | 3300007344 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHWYGLVADIKEA |
| Ga0070745_12520892 | 3300007344 | Aqueous | MDPVSLVAMASTTFKGVQILVSKGAEIEHVAQKLGHWYGLVSDIKEAEK |
| Ga0070752_10119371 | 3300007345 | Aqueous | MASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSDINQ |
| Ga0070752_10248394 | 3300007345 | Aqueous | MDPLSLVAIASSAFKGLEVLVSRGAEIEHVAKKLGHWYGLVAD |
| Ga0070753_10438211 | 3300007346 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHW |
| Ga0070753_12077552 | 3300007346 | Aqueous | VDPLSLVAMASTTFKGLQILVSKGAEIEHVAQKLGHWYGLVSDL |
| Ga0070753_12080362 | 3300007346 | Aqueous | VDPVSLVAMASTAFKGVQVLVSKGAEIEHVAQKLG |
| Ga0070753_13091702 | 3300007346 | Aqueous | MDPLSLVAMASTTFKGLQILVSKGAEIEHVAQKLGHWY |
| Ga0070753_13717671 | 3300007346 | Aqueous | MDPLSMVAMASTAFKMVEGMVARGSEIEHVAQKLGQWFTI |
| Ga0075458_102478552 | 3300007363 | Aqueous | MASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSDI |
| Ga0099849_12919293 | 3300007539 | Aqueous | MDPVSLVAIASSTFKGIQVLVSKGAEIEHVAQKLGHWYGLV |
| Ga0070751_13174012 | 3300007640 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAKKLGHWYTLVS |
| Ga0115566_106669233 | 3300009071 | Pelagic Marine | MDPLSLIAMASTTFKGIQTLVDKGAEIEHVAQKLGH |
| Ga0118687_101413161 | 3300009124 | Sediment | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAKKLGHWY |
| Ga0115545_12126901 | 3300009433 | Pelagic Marine | MDPLSLVAMASTAFKGVQVLVDRGAEIEHVAKKLGQWYT |
| Ga0129342_13243431 | 3300010299 | Freshwater To Marine Saline Gradient | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSDINQA |
| Ga0129351_13660592 | 3300010300 | Freshwater To Marine Saline Gradient | MASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSD |
| Ga0136656_12842131 | 3300010318 | Freshwater To Marine Saline Gradient | MLAMAGTVVKGIEGLVARGAEIEKVAVKLGQWYTLASDIA |
| Ga0160423_100665585 | 3300012920 | Surface Seawater | MDPLSLIALASSSFRGVQLLVNKGAEIEQVAQQLGKWFSYASD |
| Ga0160423_106074801 | 3300012920 | Surface Seawater | MIAMASTTFKGIQTLVNQGAEIERVAQKLGSWYSYAAD |
| Ga0182047_15733843 | 3300016737 | Salt Marsh | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGQWYSFAAD |
| Ga0181387_10837361 | 3300017709 | Seawater | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAKKLGH |
| Ga0181382_10418873 | 3300017756 | Seawater | MDPVSLVAMASTAFKGVEVLVSRGAEIEHVAKKLGQWYGFVSDLREAEK |
| Ga0181382_11234261 | 3300017756 | Seawater | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAKKLG |
| Ga0181423_100009051 | 3300017781 | Seawater | MDPLSLVAMASTAFKGVEVLVSRGAEIEHVAKKLG |
| Ga0181577_101049891 | 3300017951 | Salt Marsh | MIAMASTTFKGIQTLVNKGAEIEHVAQKLGAWYSYAAD |
| Ga0181577_101481053 | 3300017951 | Salt Marsh | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSDIN |
| Ga0181577_102049665 | 3300017951 | Salt Marsh | MDPLSMIAMASTTFKGIQTLVNKGAEIEHVAQKLGAWY |
| Ga0181576_101341741 | 3300017985 | Salt Marsh | MDPLSLIAMASTTFKGIQTLVNKGAEIEAVAQKLGQW |
| Ga0181576_109009942 | 3300017985 | Salt Marsh | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSD |
| Ga0181558_102448381 | 3300018417 | Salt Marsh | LVAMASTAFKGIEVLVSRGAEIEQVAQKLGHWYSFVSDLREAE |
| Ga0181592_101769295 | 3300018421 | Salt Marsh | MDPLSLIAMASTTFKGIQTLVERGAEIESVAQKLGAWYTF |
| Ga0194024_10173221 | 3300019765 | Freshwater | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGQWYSFA |
| Ga0194024_11362331 | 3300019765 | Freshwater | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGQWY |
| Ga0181574_103340254 | 3300020056 | Salt Marsh | MDPLSLIAMASTTFKGIQMMVNKGAEIEAVAQKLGQWY |
| Ga0211528_100605035 | 3300020417 | Marine | MDPLSMIAMASTTFKGIQTLVNQGAEIEAVAQKLGAWYS |
| Ga0211559_100133211 | 3300020442 | Marine | MDPLSLIAMASTTFKGIQTLVNKGAEIEHVAQKLGQWYSFAS |
| Ga0213858_104209341 | 3300021356 | Seawater | VDPVSLVAMASTTFKGVQILVSKGAEIEHVAQKLG |
| Ga0213863_103927711 | 3300021371 | Seawater | MDPLSLVAMASTAFKGVEVLVSKGAEIEHVAKKLGQWYGFVSDLREA |
| Ga0213866_103787342 | 3300021425 | Seawater | MDPLSLIAMASTTFKGIQTLVNKGAEIEHVAQKLG |
| Ga0222717_100259481 | 3300021957 | Estuarine Water | MDPLSLIAMASTTFKGIQTLVERGAEIEAVAQKFGAWY |
| Ga0222718_100813931 | 3300021958 | Estuarine Water | VDPVSLVAMASTAFKGVQVLVSKGAEIEHVAQKLGQWYTLAS |
| Ga0222716_104553222 | 3300021959 | Estuarine Water | MDPLSLVAMASTAFKGIEVLVSRGAEIEQVAQKLG |
| Ga0222715_101269051 | 3300021960 | Estuarine Water | MDPLSLVAMASTTFKGLQVLVSRGAEIEHVAQKLGHWYTLVSDINQAEK |
| Ga0212024_10185451 | 3300022065 | Aqueous | VDPVSLVAMASTAFKGVQVLVSRGAEIEHVAQKLGQWYGLVSDLR |
| Ga0212024_10544173 | 3300022065 | Aqueous | MDPVSLVAMASTAFKGVQVLVSKGAEIEHVAQKLGH |
| Ga0212026_10214363 | 3300022069 | Aqueous | MASTAFKGVQVLVSKGAEIEHVAQKLGQWYTLASD |
| Ga0212028_10263221 | 3300022071 | Aqueous | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGQW |
| Ga0196897_10382651 | 3300022158 | Aqueous | MDPVSLVAMASTTFKGVQILVSKGAEIEHVAQKLGHWYGLV |
| Ga0196893_10193001 | 3300022159 | Aqueous | VDPLSLVAMASTTFKGLQILVSKGAEIEHVAQKLGHWYGLG |
| Ga0212031_10524721 | 3300022176 | Aqueous | MDPLSLIAMASTTFKGIQTLVNRGAEIEHVAQKLGQWYSFAS |
| Ga0196891_10030774 | 3300022183 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHWYGLVADIREAEK |
| Ga0196899_11312531 | 3300022187 | Aqueous | MDPLSLVAMASTTFKGLQILVSKGAEIEHVAQKLGHWYGL |
| Ga0196899_12141412 | 3300022187 | Aqueous | MDPLSLVAMASTAFKGIEVLVSRGAEIEQVAQKLGHWYGLVSD |
| Ga0255757_100533592 | 3300023117 | Salt Marsh | MDPLSMVAMASTAFKMVEGMVARGSEIEHVAQKLGQWFTIV |
| Ga0208794_10063083 | 3300025093 | Marine | VDPVSLVAIASSTFKGIQVLVSKGAEIEHVAQKLGHWYGLV |
| Ga0208919_12467451 | 3300025128 | Marine | MDPLSLVALASSSFRGVQLLVNKGAEIEQVAQQLGKWFSYASD |
| Ga0208149_10445871 | 3300025610 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHFYGLVADIKETER |
| Ga0208149_11426331 | 3300025610 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEQVAQKLGHWYGLVSDLREA |
| Ga0208004_10750981 | 3300025630 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSDINQ |
| Ga0208428_10326623 | 3300025653 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLG |
| Ga0208428_11679301 | 3300025653 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAQKLGHW |
| Ga0208795_10103391 | 3300025655 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEQVAQKLGHWYGL |
| Ga0208898_10338921 | 3300025671 | Aqueous | MDPVSLVAMASTAFKGVQVLVSKGAEIEHVAQKLGQWYGL |
| Ga0208898_11283782 | 3300025671 | Aqueous | MDPLSLVAMASTTFKGLQILVSKGAEIEHVAQKLGHWYGLVS |
| Ga0208898_11431551 | 3300025671 | Aqueous | VDPLSLVAMASTAFKGIEVLVSRGAEIEHVAQKLGHWYS |
| Ga0208162_10053561 | 3300025674 | Aqueous | MDPLSLVAMASTTFKGLQVLVSRGAEIEHVAQKLGHWYTLV |
| Ga0208019_11799471 | 3300025687 | Aqueous | MDPLSLIAMASTTFKGIQTLVNRGAEIEHVAQKLGQWYSF |
| Ga0208150_10446021 | 3300025751 | Aqueous | MDPVSLVAMASTTFKGVQILVSKGAEIEHVAQKLGHW |
| Ga0208150_11747813 | 3300025751 | Aqueous | MDPLSLVAMASTTFKGLQVLVSKGAEIEHVAKKLGHWYTL |
| Ga0208899_10171454 | 3300025759 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHWYGLVA |
| Ga0208899_10366483 | 3300025759 | Aqueous | MDPLSLIAMASTTFKGIQTLVNQGAEIESVAQKLGQWYRFAS |
| Ga0208767_10542963 | 3300025769 | Aqueous | MDPLSLIAMASTTFKGIQTLVNQGAEIESVAQKLGQWYRFASD |
| Ga0208767_10870793 | 3300025769 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLG |
| Ga0208425_10380693 | 3300025803 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGH |
| Ga0208542_10005811 | 3300025818 | Aqueous | MDPLSLIAMASTTFKGIQTLVERGAEIEAVAQKLGAWYSFA |
| Ga0208542_10023259 | 3300025818 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHWY |
| Ga0208542_10278531 | 3300025818 | Aqueous | MASTAFKGVEILVSRGAEIEHVAQKLGHWYGFVSDLREAEKE |
| Ga0208547_10204185 | 3300025828 | Aqueous | MDPVSLVAMASTAFKGVQVLVSKGAEIEHVAQKLGQW |
| Ga0208645_10331781 | 3300025853 | Aqueous | MDPLSLVAIASSAFKGLEVLVSKGAEIEHVAKKLGHFYGLVADI |
| Ga0208645_12406932 | 3300025853 | Aqueous | VDPLSLVAMASTAFKGVEVLVSRGVEIEQVAQKLGHWYGLVSDLREAEK |
| Ga0348335_035382_1_108 | 3300034374 | Aqueous | MDPLSLIAMASTTFKGIQTLVNRGAEIEAVAQKLGQ |
| Ga0348336_050791_1_126 | 3300034375 | Aqueous | MDPVSLVAMASTTFKGVQILVSKGAEIEHVAQKLGHWYGLVS |
| Ga0348336_204507_2_106 | 3300034375 | Aqueous | MDPLSMLAMASTVVKGIEGLVARGAEIEKVATKLG |
| Ga0348337_005538_8141_8263 | 3300034418 | Aqueous | MASTTFKGLQVLVSKGAEIEHVAQKLGHWYTLVSDINQAER |
| ⦗Top⦘ |