


| Basic Information | |
|---|---|
| Family ID | F087006 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRND |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.82 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 92.73 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.04% β-sheet: 0.00% Coil/Unstructured: 86.96% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 29.09 |
| PF00296 | Bac_luciferase | 6.36 |
| PF00106 | adh_short | 6.36 |
| PF03328 | HpcH_HpaI | 3.64 |
| PF02417 | Chromate_transp | 3.64 |
| PF00885 | DMRL_synthase | 2.73 |
| PF12681 | Glyoxalase_2 | 2.73 |
| PF00903 | Glyoxalase | 1.82 |
| PF01183 | Glyco_hydro_25 | 1.82 |
| PF04909 | Amidohydro_2 | 1.82 |
| PF13378 | MR_MLE_C | 1.82 |
| PF01370 | Epimerase | 1.82 |
| PF02515 | CoA_transf_3 | 1.82 |
| PF02627 | CMD | 0.91 |
| PF01063 | Aminotran_4 | 0.91 |
| PF05016 | ParE_toxin | 0.91 |
| PF01569 | PAP2 | 0.91 |
| PF01042 | Ribonuc_L-PSP | 0.91 |
| PF01402 | RHH_1 | 0.91 |
| PF13466 | STAS_2 | 0.91 |
| PF08502 | LeuA_dimer | 0.91 |
| PF03473 | MOSC | 0.91 |
| PF12770 | CHAT | 0.91 |
| PF12773 | DZR | 0.91 |
| PF02518 | HATPase_c | 0.91 |
| PF07883 | Cupin_2 | 0.91 |
| PF10397 | ADSL_C | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 6.36 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 3.64 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 3.64 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 3.64 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 3.64 |
| COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 2.73 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.82 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.82 |
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.91 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.91 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.91 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.00 % |
| Unclassified | root | N/A | 10.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10107400 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300000956|JGI10216J12902_100046122 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300002560|JGI25383J37093_10195198 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300002908|JGI25382J43887_10014883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4057 | Open in IMG/M |
| 3300004157|Ga0062590_100309281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1236 | Open in IMG/M |
| 3300004463|Ga0063356_102658090 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005166|Ga0066674_10257095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 827 | Open in IMG/M |
| 3300005181|Ga0066678_10021735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3372 | Open in IMG/M |
| 3300005332|Ga0066388_102620713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 919 | Open in IMG/M |
| 3300005353|Ga0070669_100876744 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005445|Ga0070708_102252554 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005471|Ga0070698_100822075 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005576|Ga0066708_11063752 | Not Available | 502 | Open in IMG/M |
| 3300005577|Ga0068857_102158917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300005713|Ga0066905_100751131 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005719|Ga0068861_101847120 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005764|Ga0066903_104202316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 770 | Open in IMG/M |
| 3300005843|Ga0068860_100080975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3088 | Open in IMG/M |
| 3300006755|Ga0079222_10292688 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300006844|Ga0075428_100522387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1270 | Open in IMG/M |
| 3300006845|Ga0075421_100986826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300006846|Ga0075430_101775360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300006852|Ga0075433_11797848 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006853|Ga0075420_101161373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 664 | Open in IMG/M |
| 3300006871|Ga0075434_100424532 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300006876|Ga0079217_11548721 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009089|Ga0099828_11279991 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009094|Ga0111539_10699013 | Not Available | 1180 | Open in IMG/M |
| 3300009100|Ga0075418_12052665 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009137|Ga0066709_100001020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17388 | Open in IMG/M |
| 3300009137|Ga0066709_100429390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1841 | Open in IMG/M |
| 3300009820|Ga0105085_1023872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300010043|Ga0126380_10201709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1333 | Open in IMG/M |
| 3300010043|Ga0126380_12030178 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010047|Ga0126382_10477220 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300010047|Ga0126382_10488460 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 986 | Open in IMG/M |
| 3300010047|Ga0126382_11285579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 660 | Open in IMG/M |
| 3300010326|Ga0134065_10149151 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300010329|Ga0134111_10510921 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010358|Ga0126370_10274111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1323 | Open in IMG/M |
| 3300010359|Ga0126376_12067662 | Not Available | 612 | Open in IMG/M |
| 3300010360|Ga0126372_12748995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300010362|Ga0126377_10206718 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
| 3300010366|Ga0126379_13576119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300010398|Ga0126383_13280626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300010398|Ga0126383_13593436 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300012202|Ga0137363_11441422 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012207|Ga0137381_11225661 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012349|Ga0137387_10999939 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012355|Ga0137369_10242208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1368 | Open in IMG/M |
| 3300012357|Ga0137384_10049955 | All Organisms → cellular organisms → Bacteria | 3460 | Open in IMG/M |
| 3300012358|Ga0137368_10612994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 690 | Open in IMG/M |
| 3300012358|Ga0137368_10912840 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300012918|Ga0137396_11102082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
| 3300012930|Ga0137407_10700145 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300012948|Ga0126375_10267260 | Not Available | 1168 | Open in IMG/M |
| 3300015264|Ga0137403_10232227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1763 | Open in IMG/M |
| 3300015371|Ga0132258_10641890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2669 | Open in IMG/M |
| 3300015372|Ga0132256_101242204 | Not Available | 858 | Open in IMG/M |
| 3300015374|Ga0132255_101331597 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300018074|Ga0184640_10377249 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300018079|Ga0184627_10245892 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300018079|Ga0184627_10672751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300018433|Ga0066667_11933224 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300019360|Ga0187894_10209673 | Not Available | 946 | Open in IMG/M |
| 3300019361|Ga0173482_10358882 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300020074|Ga0194113_10170932 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300021073|Ga0210378_10370910 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300021080|Ga0210382_10259889 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300021560|Ga0126371_12517948 | Not Available | 623 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10003609 | All Organisms → cellular organisms → Bacteria | 9853 | Open in IMG/M |
| 3300025912|Ga0207707_11035008 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300025912|Ga0207707_11501733 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300025921|Ga0207652_10688880 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300025923|Ga0207681_10504107 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300025942|Ga0207689_11704685 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026285|Ga0209438_1129318 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300026342|Ga0209057_1154034 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300026497|Ga0257164_1092499 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026537|Ga0209157_1369786 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026538|Ga0209056_10011876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8784 | Open in IMG/M |
| 3300027379|Ga0209842_1079878 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300027511|Ga0209843_1064911 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300027748|Ga0209689_1359655 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300027787|Ga0209074_10236691 | Not Available | 703 | Open in IMG/M |
| 3300027909|Ga0209382_11086227 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 827 | Open in IMG/M |
| 3300027909|Ga0209382_12153703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
| 3300028380|Ga0268265_11212400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
| 3300028381|Ga0268264_10837701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 921 | Open in IMG/M |
| 3300028828|Ga0307312_11133383 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300028889|Ga0247827_10673646 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300030006|Ga0299907_10992013 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
| 3300030620|Ga0302046_10887079 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
| 3300030903|Ga0308206_1056585 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031092|Ga0308204_10237799 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031152|Ga0307501_10181996 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031782|Ga0318552_10344642 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031805|Ga0318497_10106172 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300031949|Ga0214473_10736848 | Not Available | 1070 | Open in IMG/M |
| 3300032000|Ga0310903_10076326 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300032012|Ga0310902_11142972 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300032180|Ga0307471_100980115 | Not Available | 1012 | Open in IMG/M |
| 3300032180|Ga0307471_101688603 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300032180|Ga0307471_101959183 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
| 3300032205|Ga0307472_102358017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300033289|Ga0310914_10971660 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300033550|Ga0247829_11175615 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300034176|Ga0364931_0086893 | Not Available | 979 | Open in IMG/M |
| 3300034177|Ga0364932_0156828 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 866 | Open in IMG/M |
| 3300034661|Ga0314782_105285 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.73% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.73% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.73% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.91% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.91% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_101074001 | 3300000597 | Forest Soil | MIVDIHAHYFPKEYLDLLVSIGGRSLPEAARPLTARPG |
| JGI10216J12902_1000461222 | 3300000956 | Soil | MIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQDDPAGIL |
| JGI25383J37093_101951982 | 3300002560 | Grasslands Soil | MIVDIHAHYFPKEYNDTLLRIGGRSVPEAARPTTARPMRNDD |
| JGI25382J43887_100148836 | 3300002908 | Grasslands Soil | MIVDIHAHYFPKAYNDALLRIGGRSLPEAARSLTARTIRN |
| Ga0062590_1003092813 | 3300004157 | Soil | MIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMRHDDP |
| Ga0063356_1026580902 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMRHDDPSGLP |
| Ga0066674_102570951 | 3300005166 | Soil | MIVDIHAHYLPKVYNDILLRIGGRSLPEAARPSTARPMRNDD |
| Ga0066678_100217355 | 3300005181 | Soil | MIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRNDDLA |
| Ga0066388_1026207133 | 3300005332 | Tropical Forest Soil | MIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQ |
| Ga0070669_1008767443 | 3300005353 | Switchgrass Rhizosphere | MIVDIHAHYFPKAYNDLLLRIGGRSLPEAARPSTARPMRND |
| Ga0070708_1022525541 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVDVHAHYFPKEYTDILMRIGGRSLPEAARPRTARPMRQDAPAGI |
| Ga0070698_1008220751 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRNDDLAGI |
| Ga0066708_110637522 | 3300005576 | Soil | VIVDIHAHYFPRAYNDLLVRIGGRSLPEAARALTARPMRHDDAAEIAT |
| Ga0068857_1021589171 | 3300005577 | Corn Rhizosphere | MIVDIHAHYFPKTYIDTLLRIGGRSLPEAARAITKRTIRND |
| Ga0066905_1007511311 | 3300005713 | Tropical Forest Soil | MIVDIHAHYFPQEYTDLLMRIGGRTLPEAARPLTARPMRQDAPA |
| Ga0068861_1018471202 | 3300005719 | Switchgrass Rhizosphere | MIVDIHAHYFAKEYIDLLMSIGGRSVPEAARALTAGQ |
| Ga0066903_1042023162 | 3300005764 | Tropical Forest Soil | MIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTAR |
| Ga0068860_1000809751 | 3300005843 | Switchgrass Rhizosphere | MIVDIHAHYFPKAYNDLLLRIGGRSLPEAARPSTARPMRNDDPS |
| Ga0079222_102926882 | 3300006755 | Agricultural Soil | MIVDVHAHYFPKAYMDLLVRIGGRSLPEAARAITARPLRYD |
| Ga0075428_1005223871 | 3300006844 | Populus Rhizosphere | MIVDIHAHYFPKDYNDLLLRIGGRSLPEAARASTARPMRNDDLSGIP |
| Ga0075421_1009868262 | 3300006845 | Populus Rhizosphere | MIVDIHAHYFPKTYIDTLLRIGGRSLPEAARAITKRTIRNDDPSQI |
| Ga0075430_1017753601 | 3300006846 | Populus Rhizosphere | MIVDIHAHYFPKTYIDTLLRIGGRSLPEAARAITKRTIRNDDPSQIPTR |
| Ga0075433_117978481 | 3300006852 | Populus Rhizosphere | MIADIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRNDDLTGI |
| Ga0075420_1011613731 | 3300006853 | Populus Rhizosphere | MIVDVHAHYFPREYTDLLMRIGGRTLPEAARPLTARPMR |
| Ga0075434_1004245323 | 3300006871 | Populus Rhizosphere | MIVDVHAHYFPQAYTDILMRIGGRSLPEAARPRTARPMRQDNP |
| Ga0079217_115487212 | 3300006876 | Agricultural Soil | VIVDIHAHYFPKAYNDTLLRIGGRSLPESARALTARPPRND |
| Ga0099828_112799911 | 3300009089 | Vadose Zone Soil | MIVDIHAHYFPKEYNDLLLRIGGRSVPEAARPITARPMRQDDS |
| Ga0111539_106990132 | 3300009094 | Populus Rhizosphere | MIVDIHAHYFPRAYNDALMGIGGRSLPEAARALTARPPR |
| Ga0075418_120526651 | 3300009100 | Populus Rhizosphere | MIVDVHAHYFPKEYNDLLLRIGGRSLPEAARPATARPMRDD |
| Ga0066709_10000102021 | 3300009137 | Grasslands Soil | MIVDIPAHYFPKEYNDLLLRIGGRSLPDGAPPITPRPTRPGRCLG |
| Ga0066709_1004293901 | 3300009137 | Grasslands Soil | MIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQDDP |
| Ga0105085_10238723 | 3300009820 | Groundwater Sand | MIVDIHAHYFPKEYNDILLRIGGRSLPEAARPITARPMREDDSAK |
| Ga0126380_102017093 | 3300010043 | Tropical Forest Soil | VIVDIHAHYFPKAYNATLLRIGGRSLPESARALTA |
| Ga0126380_120301782 | 3300010043 | Tropical Forest Soil | MIVDIHAHYFPQSYLNLLVRIGGRSLPEAARPLTARP |
| Ga0126382_104772201 | 3300010047 | Tropical Forest Soil | MIVDIHAHYFAKEYIDLLMSIGGRSVPVAARALTAG |
| Ga0126382_104884602 | 3300010047 | Tropical Forest Soil | MIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARP |
| Ga0126382_112855791 | 3300010047 | Tropical Forest Soil | MIVDVHAHYFPKPYIETLMRIGGRSLPEAARALTPRPLMQ |
| Ga0134065_101491511 | 3300010326 | Grasslands Soil | MIVDIHAHYFPNPYNDALLRIGGRSLPEAARSLTARTIRNDDPS |
| Ga0134111_105109211 | 3300010329 | Grasslands Soil | MIVDVHAHYFPKAYNELLVRIGGKSLPEAARPLTARPMREDDAS |
| Ga0126370_102741112 | 3300010358 | Tropical Forest Soil | VIVDIHAHYFPKAYNDTLQRIGGRSLPESARALTARPPRNDEPS |
| Ga0126376_120676622 | 3300010359 | Tropical Forest Soil | MIVDVHAHYFPKEYTDLLMRIGGHSLPEAARPRTARPMRQD |
| Ga0126372_127489951 | 3300010360 | Tropical Forest Soil | VIVDIHAHYFPKAYNDTLLRIGGRSLPESARALTARP |
| Ga0126377_102067181 | 3300010362 | Tropical Forest Soil | MIVDIHAHYFPQEYTDLLLRIGGRTLPEAARPLTARPMR |
| Ga0126379_135761192 | 3300010366 | Tropical Forest Soil | MIVDIHAHYFPKEYIDLLVSIGGRSLPEAARLLTA* |
| Ga0126383_132806262 | 3300010398 | Tropical Forest Soil | MARVIVDVHAHYFPKSYIETLMRIGGRSLPEAARALTPRPLMQDDPAGLEKRF |
| Ga0126383_135934362 | 3300010398 | Tropical Forest Soil | MIVDIHAHYFPKAYNDTLVRIGGRSLPEVARAMTARPMRHDDLTG |
| Ga0137363_114414222 | 3300012202 | Vadose Zone Soil | MIVDLHAHYFPKDYNAILLRIGGRSLPEAARPITARPMREDDP |
| Ga0137381_112256612 | 3300012207 | Vadose Zone Soil | MIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPSTARPMRNDDLAGIQ |
| Ga0137387_109999392 | 3300012349 | Vadose Zone Soil | MIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRNDDAAGIP |
| Ga0137369_102422081 | 3300012355 | Vadose Zone Soil | MIVDIHAHYFPKEYNDLLLRIGGRSVPEAARPITARPMRQ |
| Ga0137384_100499555 | 3300012357 | Vadose Zone Soil | MIVDLHAHYFPKDYNAILLRIGGRSLPEAARPITARPMREDD |
| Ga0137368_106129941 | 3300012358 | Vadose Zone Soil | MIADVHAHYFPKAYTDLLLRIGGRSLPEAARPRTARPMRQDDPA |
| Ga0137368_109128401 | 3300012358 | Vadose Zone Soil | MIIDVHAHFFPKAYTDLLLRIGGRSLPEAARPRTA |
| Ga0137396_111020822 | 3300012918 | Vadose Zone Soil | MIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRND |
| Ga0137407_107001452 | 3300012930 | Vadose Zone Soil | MIVDVHAHYFPQEYTDILMRIGGRSLPEAARPRTARPLRQDD |
| Ga0126375_102672601 | 3300012948 | Tropical Forest Soil | VIVDIHAHYFPKAYNDTLLRIGGRSLPESARALTA |
| Ga0137403_102322273 | 3300015264 | Vadose Zone Soil | MIVDVHAHYFPQEYNDILMRIGGRSLPEAARPRTAR |
| Ga0132258_106418905 | 3300015371 | Arabidopsis Rhizosphere | MIVDIHAHYFPKAYNDKLLSIGGRSLPEAARALTARPMR |
| Ga0132256_1012422042 | 3300015372 | Arabidopsis Rhizosphere | MIVDIHAHYFPQGYTDLLMRIGGRTLPEAARPLTARPMRQD |
| Ga0132255_1013315971 | 3300015374 | Arabidopsis Rhizosphere | MIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQE |
| Ga0184640_103772491 | 3300018074 | Groundwater Sediment | MIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPTTARPMRNDD |
| Ga0184627_102458921 | 3300018079 | Groundwater Sediment | MIVDIHAHYFPQAYNDLLLRIGGRSLPEAARPRTARPMRT |
| Ga0184627_106727512 | 3300018079 | Groundwater Sediment | MIIDVHAHYFPKAYNDLLLRIGGRSLPEAARPITAR |
| Ga0066667_119332241 | 3300018433 | Grasslands Soil | MIVDVHAHYFPQAYTDILMRIGGRSLPEAARPRTARPMRQDAP |
| Ga0187894_102096731 | 3300019360 | Microbial Mat On Rocks | VIVDIHAHYFPKAYMDTLVSIGGLSRPEATRPRTARPLRHDDP |
| Ga0173482_103588821 | 3300019361 | Soil | MIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITA |
| Ga0194113_101709323 | 3300020074 | Freshwater Lake | MPAMITDIHAHYFPQAYNETLLRIGGRSLPEAARAITARAIRHDDPSQIP |
| Ga0210378_103709101 | 3300021073 | Groundwater Sediment | MIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPTTARPMRNDDASGIA |
| Ga0210382_102598892 | 3300021080 | Groundwater Sediment | MIVDIHAHYFPKAYNDTLVRIGGRSLPEAARAITARAPRN |
| Ga0126371_125179482 | 3300021560 | Tropical Forest Soil | VIVDIHAHYFPKAYNNMLLRIGGRSLPESARALTARPPRNDEPSSI |
| (restricted) Ga0233424_1000360914 | 3300023208 | Freshwater | MIVDIHAHYFPKAYNDTLLRIGGRSLPEAARAITAIPGRP |
| Ga0207707_110350081 | 3300025912 | Corn Rhizosphere | MIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMRH |
| Ga0207707_115017332 | 3300025912 | Corn Rhizosphere | MIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMR |
| Ga0207652_106888802 | 3300025921 | Corn Rhizosphere | MIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMRHDDPAGLPE |
| Ga0207681_105041072 | 3300025923 | Switchgrass Rhizosphere | MIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPSTAR |
| Ga0207689_117046851 | 3300025942 | Miscanthus Rhizosphere | MIVDIHAHYFPQAYTDLLMRIGGRSLPDSARPRTARPMRQDDP |
| Ga0209438_11293182 | 3300026285 | Grasslands Soil | MIVDIHAHYFPKAYNDALLRIGGRSLPEAARSLTARTIRND |
| Ga0209057_11540342 | 3300026342 | Soil | MIVDIHAHYFPKPYNDALLRIGGRSLPEAARSLTARTIRND |
| Ga0257164_10924992 | 3300026497 | Soil | MIVDLHAHYFPKDYNAILLRIGGRSLPEAARPITARPMREDDPAGLATR |
| Ga0209157_13697862 | 3300026537 | Soil | MIVDIHAHYFGKEYIDRLMSIGGRSVPEAARALTAG |
| Ga0209056_100118761 | 3300026538 | Soil | MIVDIHAHYFPKPYNDALLCIGGRSLPEAARSLTART |
| Ga0209842_10798782 | 3300027379 | Groundwater Sand | MIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPTTARP |
| Ga0209843_10649112 | 3300027511 | Groundwater Sand | MIVDIHAHYFPKEYTDLLVRIGGRSLPESARALTARPIRQDDSSG |
| Ga0209689_13596551 | 3300027748 | Soil | MIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTAR |
| Ga0209074_102366912 | 3300027787 | Agricultural Soil | MIVDIHAHYFPKAYNDLLVRIGGRSLPEAARALTARPMRHDD |
| Ga0209382_110862273 | 3300027909 | Populus Rhizosphere | MIVDIHAHYFPKAYNDKLVSIGGKSLPEAARALTA |
| Ga0209382_121537032 | 3300027909 | Populus Rhizosphere | MIVDIHAHYFPKAYNALLMRIGGKSLPESARALTAR |
| Ga0268265_112124001 | 3300028380 | Switchgrass Rhizosphere | MIVDIHAHYFPKPYNDLLLRIGGRSLPEAARPSTARPMRNDDPSGI |
| Ga0268264_108377012 | 3300028381 | Switchgrass Rhizosphere | MIVDIHAHYFPKEYNALLLRIGGKSLPEAARAITARRMRDDDLSGIP |
| Ga0307312_111333832 | 3300028828 | Soil | MIVDLHAHYFPKDYNALLLRIGGRSLPEAARPITARPMREDDPA |
| Ga0247827_106736462 | 3300028889 | Soil | MIVDIHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQ |
| Ga0299907_109920131 | 3300030006 | Soil | MIVDVHAHYFPQAYTDFLLRIGGRSLPEAARSLTAQSMRR |
| Ga0302046_108870792 | 3300030620 | Soil | MIVDLHAHHSSREYVETLTRIGGKSLPEAARSLTARPMRMDNPNDLEQRF |
| Ga0308206_10565851 | 3300030903 | Soil | MVVDVHADYFPQEYTDILMCIGGRSLPEAARLLNDRYAGLV |
| Ga0308204_102377992 | 3300031092 | Soil | MIVDVHAHYFPQEYTDILMRIGGRSLPEAARPRTARPMRQDDP |
| Ga0307501_101819961 | 3300031152 | Soil | MIVDIHAHYFPKEYNDLLVRIGGRSLPEAARPSTARPMRNDD |
| Ga0318552_103446421 | 3300031782 | Soil | MIVDIHAHYFPKDYNDLLLRIGGRRLPEAARPITARPMRNHDPASIEK |
| Ga0318497_101061722 | 3300031805 | Soil | MIVDIHAHYFPKDYNDLLLRIGGRSLPEAARPITARP |
| Ga0214473_107368482 | 3300031949 | Soil | MIVDIHAHYFPKAYNDLLLRIGGRSLPEAARPITARPMREDDPSG |
| Ga0310903_100763263 | 3300032000 | Soil | MIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPSTARP |
| Ga0310902_111429721 | 3300032012 | Soil | MIVDIHAHYFPQAYTDLLMRIGGRSLPEAARPRTARPMRQDDPAG |
| Ga0307471_1009801152 | 3300032180 | Hardwood Forest Soil | MIVDIHAHFFPQAYMDLLMRIGGKSLPEAARPLTGRPGGRP |
| Ga0307471_1016886031 | 3300032180 | Hardwood Forest Soil | MIVDIHAHYFAKEYIDRLMSIGGRSVPEAARALTAGQLRR |
| Ga0307471_1019591832 | 3300032180 | Hardwood Forest Soil | MIVDIHAHYFPKAYNDLLLRIGGRSLPEAARPSTARPMRNDDPSGIP |
| Ga0307472_1023580172 | 3300032205 | Hardwood Forest Soil | MIVDIHAHYFPQAYMDLLMRIGGKSLPEAARPLTARPGGRPHDPN |
| Ga0310914_109716602 | 3300033289 | Soil | MIVDIHAHYFPKDYNDLLLRIGGRRLPEAARPITARP |
| Ga0247829_111756152 | 3300033550 | Soil | MIVDVHAHYFPKEYNDLLLRIGGRSLPEAARPATARPMR |
| Ga0364931_0086893_1_111 | 3300034176 | Sediment | MIVDVHAHYFPKAYNDILMRIGGRSLPEAARPITARP |
| Ga0364932_0156828_723_866 | 3300034177 | Sediment | MIVDVHAHYFPQGYTDLLICIGGRGLPEAARPITARPMRQDDPAGIPT |
| Ga0314782_105285_511_642 | 3300034661 | Soil | MIVDIHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQNDPA |
| ⦗Top⦘ |