


| Basic Information | |
|---|---|
| Family ID | F086992 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARR |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.73 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 92.73 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.364 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.29% β-sheet: 0.00% Coil/Unstructured: 75.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02769 | AIRS_C | 68.18 |
| PF13458 | Peripla_BP_6 | 5.45 |
| PF01070 | FMN_dh | 1.82 |
| PF01029 | NusB | 1.82 |
| PF00677 | Lum_binding | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.82 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.82 |
| COG0307 | Riboflavin synthase alpha chain | Coenzyme transport and metabolism [H] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.36 % |
| Unclassified | root | N/A | 3.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459017|G14TP7Y01CRNKT | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300000890|JGI11643J12802_12001762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1005 | Open in IMG/M |
| 3300002911|JGI25390J43892_10019845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1613 | Open in IMG/M |
| 3300004081|Ga0063454_100637152 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300004081|Ga0063454_101188725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 630 | Open in IMG/M |
| 3300004081|Ga0063454_101459638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 583 | Open in IMG/M |
| 3300004152|Ga0062386_100521606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 966 | Open in IMG/M |
| 3300004643|Ga0062591_101530484 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005167|Ga0066672_10862906 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005332|Ga0066388_100504698 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300005332|Ga0066388_107988707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris → Blastochloris sulfoviridis | 529 | Open in IMG/M |
| 3300005332|Ga0066388_108442612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300005446|Ga0066686_11053467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300005457|Ga0070662_101721114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300005467|Ga0070706_101501259 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005468|Ga0070707_101497441 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005471|Ga0070698_100231003 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300005548|Ga0070665_101945959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 593 | Open in IMG/M |
| 3300005554|Ga0066661_10606033 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005568|Ga0066703_10513487 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005616|Ga0068852_101724659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300005713|Ga0066905_100046068 | All Organisms → cellular organisms → Bacteria | 2630 | Open in IMG/M |
| 3300005713|Ga0066905_101402797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300005764|Ga0066903_101112637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris | 1457 | Open in IMG/M |
| 3300005764|Ga0066903_101319368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
| 3300005937|Ga0081455_10660428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris | 672 | Open in IMG/M |
| 3300006049|Ga0075417_10014052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3059 | Open in IMG/M |
| 3300006755|Ga0079222_11198170 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006904|Ga0075424_100680573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300009094|Ga0111539_11805689 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300009551|Ga0105238_10431383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1314 | Open in IMG/M |
| 3300009792|Ga0126374_11039588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 645 | Open in IMG/M |
| 3300009792|Ga0126374_11593282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300010371|Ga0134125_10144508 | All Organisms → cellular organisms → Bacteria | 2649 | Open in IMG/M |
| 3300010373|Ga0134128_10868875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 999 | Open in IMG/M |
| 3300010376|Ga0126381_101643620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300010398|Ga0126383_10548181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300010398|Ga0126383_12134564 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012096|Ga0137389_11599188 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012354|Ga0137366_10444169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300012469|Ga0150984_115710083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1547 | Open in IMG/M |
| 3300012892|Ga0157294_10124420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 690 | Open in IMG/M |
| 3300012929|Ga0137404_11679016 | Not Available | 590 | Open in IMG/M |
| 3300012930|Ga0137407_11753585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300012930|Ga0137407_11773608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300012961|Ga0164302_10246445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1132 | Open in IMG/M |
| 3300012971|Ga0126369_10669660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300012971|Ga0126369_13496203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300012985|Ga0164308_10012338 | All Organisms → cellular organisms → Bacteria | 4710 | Open in IMG/M |
| 3300012986|Ga0164304_11885682 | Not Available | 500 | Open in IMG/M |
| 3300015371|Ga0132258_11581886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1655 | Open in IMG/M |
| 3300015373|Ga0132257_100109741 | All Organisms → cellular organisms → Bacteria | 3188 | Open in IMG/M |
| 3300016270|Ga0182036_10925860 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300016319|Ga0182033_11266329 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300016387|Ga0182040_10178957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1540 | Open in IMG/M |
| 3300016404|Ga0182037_10202547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1540 | Open in IMG/M |
| 3300016445|Ga0182038_11208559 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300017974|Ga0187777_10673077 | Not Available | 733 | Open in IMG/M |
| 3300018468|Ga0066662_11583318 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300019767|Ga0190267_10215962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 914 | Open in IMG/M |
| 3300020583|Ga0210401_10619353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris | 944 | Open in IMG/M |
| 3300021401|Ga0210393_11415264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300021475|Ga0210392_11003784 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021479|Ga0210410_11263618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300021560|Ga0126371_10898778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300025922|Ga0207646_11897861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris | 508 | Open in IMG/M |
| 3300025942|Ga0207689_11531254 | Not Available | 556 | Open in IMG/M |
| 3300026023|Ga0207677_11235082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300026297|Ga0209237_1135541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 998 | Open in IMG/M |
| 3300026309|Ga0209055_1242861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300026310|Ga0209239_1157210 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300026552|Ga0209577_10162061 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300027882|Ga0209590_10008848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4603 | Open in IMG/M |
| 3300027903|Ga0209488_10904924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 618 | Open in IMG/M |
| 3300027907|Ga0207428_10167210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1667 | Open in IMG/M |
| 3300028712|Ga0307285_10180149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 587 | Open in IMG/M |
| 3300028720|Ga0307317_10192264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 688 | Open in IMG/M |
| 3300028720|Ga0307317_10296913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 546 | Open in IMG/M |
| 3300028793|Ga0307299_10268342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris | 641 | Open in IMG/M |
| 3300031093|Ga0308197_10163481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 727 | Open in IMG/M |
| 3300031226|Ga0307497_10175609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 910 | Open in IMG/M |
| 3300031231|Ga0170824_128376764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1542 | Open in IMG/M |
| 3300031469|Ga0170819_16097559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 733 | Open in IMG/M |
| 3300031572|Ga0318515_10777171 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031680|Ga0318574_10223502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300031681|Ga0318572_10684884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300031682|Ga0318560_10316416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300031720|Ga0307469_11339125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300031771|Ga0318546_10372279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris | 996 | Open in IMG/M |
| 3300031782|Ga0318552_10098305 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300031792|Ga0318529_10336777 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031793|Ga0318548_10412258 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031797|Ga0318550_10228722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
| 3300031821|Ga0318567_10062429 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
| 3300031832|Ga0318499_10025237 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300031890|Ga0306925_10351555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1583 | Open in IMG/M |
| 3300031890|Ga0306925_11399386 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031890|Ga0306925_12190511 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031893|Ga0318536_10524852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300031941|Ga0310912_11270433 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031954|Ga0306926_12740709 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032001|Ga0306922_12029427 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032043|Ga0318556_10087257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1566 | Open in IMG/M |
| 3300032054|Ga0318570_10368724 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032063|Ga0318504_10468664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris | 602 | Open in IMG/M |
| 3300032076|Ga0306924_10008813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10200 | Open in IMG/M |
| 3300032180|Ga0307471_101067395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
| 3300032205|Ga0307472_102443817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300034090|Ga0326723_0182570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris | 927 | Open in IMG/M |
| 3300034149|Ga0364929_0073313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1059 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.91% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4ZMR_04597440 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRNV |
| JGI11643J12802_120017622 | 3300000890 | Soil | MHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRARRYVPSF |
| JGI25390J43892_100198453 | 3300002911 | Grasslands Soil | MHDMTGLVRPAKDYTPSDNPRFLELHRRFPTIAYLRQRAR |
| Ga0063454_1006371522 | 3300004081 | Soil | MHDTTALARPASPYNPADNPHFSELHRRFPTVAYLRRHARRQVP |
| Ga0063454_1011887251 | 3300004081 | Soil | MHDTTALARPANPYNPADNPRFSKLHRRFPTVAYLRRHARRQVPNFA |
| Ga0063454_1014596381 | 3300004081 | Soil | MHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRHARRQVP |
| Ga0062386_1005216061 | 3300004152 | Bog Forest Soil | MDDTTALVRPAAKDYTPADNPRFLGLHRRFPSIAYLRHHARRH |
| Ga0062591_1015304841 | 3300004643 | Soil | MHDTTALTRPTAARKDYTPADNPAFVKLHRRFPAVPYLRR |
| Ga0066672_108629062 | 3300005167 | Soil | MDDRTALVRPATKDYAPADDPSFPRLHRRFPTVAYLRRHAR |
| Ga0066388_1005046981 | 3300005332 | Tropical Forest Soil | MQDTTAVTRPNVKIYTPADNPGFTRLHRRFPTVAYLRKQA |
| Ga0066388_1079887072 | 3300005332 | Tropical Forest Soil | MHDTTAVTRPNVKVYTPADNPRFVALHRRFPTVAYLRRQARRRLPH |
| Ga0066388_1084426122 | 3300005332 | Tropical Forest Soil | MDDRTGLARTAADDYTPADNPSFVQLHRRFPTIHHLRRHARARLPRFAFEYLD |
| Ga0066686_110534672 | 3300005446 | Soil | MHDTTAVARPAAQDHTPADNPRFVKLHRRFPTTAHLRAHA |
| Ga0070662_1017211141 | 3300005457 | Corn Rhizosphere | MQDTTALVSPAAKDYVPADNPRFVKLHRRFPTVLYLRRHARRHVPRFAFEYM |
| Ga0070706_1015012591 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHDTTALVRSAENDYTPVDNPRFLKLHRRFPTIAYLRQHARSHV |
| Ga0070707_1014974411 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDTTALVRSAASDYTPADNPRFLKLHRRFPTVAYLRQHARSH |
| Ga0070698_1002310033 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHDTTAVTRPNVKVYTPADNPRFPKLHRRFPTVAYLRRQARRKLPHFAFEYC |
| Ga0070665_1019459592 | 3300005548 | Switchgrass Rhizosphere | MHDTTALARPASPYNPADNPRFSKLHRRFPTVAYLRRHARRQVP |
| Ga0066661_106060332 | 3300005554 | Soil | MHDTTALLRSAASDYTPADNSRFPKLHRRFPTTAYLRQHARS |
| Ga0066703_105134871 | 3300005568 | Soil | MHDTTALLRSAASDYTPADNSRFPKLHRRFPTTAYLRQHA |
| Ga0068852_1017246591 | 3300005616 | Corn Rhizosphere | MHDTTALARPASPYNPADNPRFSALHRRFPTVTYLRRHARR |
| Ga0066905_1000460683 | 3300005713 | Tropical Forest Soil | MHDTPALHRPNAKVYTPADNPRFVKLHRRFPTVAYLRRQARRKL |
| Ga0066905_1014027972 | 3300005713 | Tropical Forest Soil | MQDTTALVRPAVRNYTPADNPRFVKLHRRFPTVAYLRRHARRHVPRFAFEYMD |
| Ga0066903_1011126373 | 3300005764 | Tropical Forest Soil | MQDTTALVRPAAKDYTPADNPRFLKLHRRFPTIFYLRQHARRHVP |
| Ga0066903_1013193683 | 3300005764 | Tropical Forest Soil | MHDTTAVAKPNARIYLPAENPRFAALHRRFPTVAYLRKHAR |
| Ga0081455_106604282 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MHDTTAVTRPNVKVYTPADNPRFPKLHRRFPTVAYLRRHAR |
| Ga0075417_100140521 | 3300006049 | Populus Rhizosphere | MHDTTGLVRPAKDYTPADNPRFLELHRRFPTIAYLRE |
| Ga0079222_111981702 | 3300006755 | Agricultural Soil | MQDMTALVPPPAQDYVPADNPRFVKLHRRFPTILYLRRHARR |
| Ga0075424_1006805731 | 3300006904 | Populus Rhizosphere | MQDTTALIPPPGQDYVPADNPRFVNLHRRFPTVLYLRRHARRHVPRFAF |
| Ga0111539_118056891 | 3300009094 | Populus Rhizosphere | MQDTTALIPPPGQDYVPADNPRFVNLHRRFPTVLYLRRHARRHVPRFAFEYMD |
| Ga0105238_104313831 | 3300009551 | Corn Rhizosphere | MHDTTALARPASPYNPADNPRFSALHRRFPTVAYL |
| Ga0126374_110395882 | 3300009792 | Tropical Forest Soil | MHDTTALARPAAAYTPADNPRFLKLHRRFPTVAYLRRRARRHV |
| Ga0126374_115932822 | 3300009792 | Tropical Forest Soil | MHDTTALVWPAANDYTPADNPRFVKLYRRFPTVAYLRRHARRHVPRF |
| Ga0134125_101445081 | 3300010371 | Terrestrial Soil | MQDTTALVPPAAKDYVPADNPRFVKLHRRFPTVLYLRRH |
| Ga0134128_108688751 | 3300010373 | Terrestrial Soil | MQDTTALVSPAAKDYVPADNPRFVKLHRRFPTVLY |
| Ga0126381_1016436201 | 3300010376 | Tropical Forest Soil | MQDTTASVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRHVPSFAFEYMD |
| Ga0126383_105481811 | 3300010398 | Tropical Forest Soil | MQDTTALVRPAAKGYTPADNPRFPKLHRRFPTILYLRQHARRH |
| Ga0126383_121345642 | 3300010398 | Tropical Forest Soil | MQDTTALVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRHVPRFAFEYM |
| Ga0137389_115991882 | 3300012096 | Vadose Zone Soil | MHDTTALTRPAAATKDYTPADNPGFVKLHRRFPAVAYLRRHAR |
| Ga0137366_104441692 | 3300012354 | Vadose Zone Soil | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRNVPSFAFEY |
| Ga0150984_1157100832 | 3300012469 | Avena Fatua Rhizosphere | MHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRHARRQVPNFAFE |
| Ga0157294_101244201 | 3300012892 | Soil | MHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRARRYVPSFA |
| Ga0137404_116790162 | 3300012929 | Vadose Zone Soil | MHDTTALHRPNAKIYTPADNPRFPALHRRFPTVAYLRR |
| Ga0137407_117535851 | 3300012930 | Vadose Zone Soil | MDDRTTVARPAVKDYAPADNPSFSKLHRQFPTVAYLR |
| Ga0137407_117736082 | 3300012930 | Vadose Zone Soil | MHDTTAVTKPNVKIYTPADNPRFVALHRRFPTVAYLRRHARRKL |
| Ga0164302_102464452 | 3300012961 | Soil | MHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRHARRQV |
| Ga0126369_106696602 | 3300012971 | Tropical Forest Soil | MQDTTAPVRLAAKGYTPADNPRFLKLHRRFPTIFYLRQHAR |
| Ga0126369_134962031 | 3300012971 | Tropical Forest Soil | MHDTTALVRPAASDYTPADNPRFVKLHRRFPTLAYL |
| Ga0164308_100123387 | 3300012985 | Soil | MHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRA |
| Ga0164304_118856821 | 3300012986 | Soil | MHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRH |
| Ga0132258_115818861 | 3300015371 | Arabidopsis Rhizosphere | MQDTTALIPPPGQDYVPADNPRFVNLHRRFPTVLYLRRHARRHVPRFA |
| Ga0132257_1001097411 | 3300015373 | Arabidopsis Rhizosphere | MHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRARR |
| Ga0182036_109258602 | 3300016270 | Soil | MHDTTALARSAANDYTPADNPRFVKLHRRFPTVAYLRRHAR |
| Ga0182033_112663291 | 3300016319 | Soil | MHDTTALVRPAASDYTPADNPRFVKLYRRFPTVAYLRRHARRHV |
| Ga0182040_101789571 | 3300016387 | Soil | MQDTTALVRPAAKGYTPADNPRFLKLHRRFPTILYLRQHARRHVPSFAFEYMD |
| Ga0182037_102025471 | 3300016404 | Soil | MHDTTALVRPAASDYTPAENPRFVKLHRRFPTVAYLRRHARRHVPSFA |
| Ga0182038_112085591 | 3300016445 | Soil | MHDTTALVRPAASDYTPADNPRFVKLYRRFPTVAYLRRHARRHVPRF |
| Ga0187777_106730772 | 3300017974 | Tropical Peatland | MDDRTALVRPHANEHTPADNPRFLKLHRRFPTVAYL |
| Ga0066662_115833182 | 3300018468 | Grasslands Soil | MHDMTALGRPDAKPYAPADNPAFIGLHRRFPSIAYLRRRARRR |
| Ga0190267_102159621 | 3300019767 | Soil | MHDTTALARPASPYNPADNPRFSALHRHFPTVAYLRRHARRQLPNFA |
| Ga0210401_106193532 | 3300020583 | Soil | MHDMTALGRPDAKPYAPADNPDFIGLHRRFPSIAYL |
| Ga0210393_114152642 | 3300021401 | Soil | MHDVTALGHPDAKPYTPADNPAFIELHRRFPTIAYLRQRARRRLPRFAFEY |
| Ga0210392_110037842 | 3300021475 | Soil | MQDTTALVPPAAKDYVPADNPRFVKLHRRFPTVLYLRRHARRHVPRFA |
| Ga0210410_112636181 | 3300021479 | Soil | MHDVTALGHPDAKPYTPADNPAFIELHRRFPTIAYLRQRARRRLPRFAF |
| Ga0126371_108987782 | 3300021560 | Tropical Forest Soil | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRHV |
| Ga0207646_118978612 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRHVPRFAFE |
| Ga0207689_115312542 | 3300025942 | Miscanthus Rhizosphere | MHDTTALARPASPYNPADNPRFSALHRRFPTVTYLRRH |
| Ga0207677_112350821 | 3300026023 | Miscanthus Rhizosphere | MHDTTALARPASPYNPADNPRFSALHRRFPTVTYLRRHARRQVPRFA |
| Ga0209237_11355411 | 3300026297 | Grasslands Soil | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARR |
| Ga0209055_12428611 | 3300026309 | Soil | MHDTTALLRSAASDYTPADNSRFPKLHRRFPTTAYLRQHARSPVP |
| Ga0209239_11572102 | 3300026310 | Grasslands Soil | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRR |
| Ga0209577_101620611 | 3300026552 | Soil | MHDTTALSRPAAKDYTPADNPRFAKLHRRFPTVADLRRHARRH |
| Ga0209590_100088487 | 3300027882 | Vadose Zone Soil | MHDTTALTRPAAATKDYTPADNPGFVKLHRRFPAVAYLRRHARRHVPRFAFEYM |
| Ga0209488_109049241 | 3300027903 | Vadose Zone Soil | MHDTTALVRPASAYNPADNPRFPKLHRRFPTVAYLRRHARRHVPSF |
| Ga0207428_101672102 | 3300027907 | Populus Rhizosphere | MHDTTALARSATAYNPADNPRFSKLHRRFPTVAYLRRRARRY |
| Ga0307285_101801491 | 3300028712 | Soil | MHDTTALARPANPYNPADNPRFSKLHRRFPTVAYLRRHARRQVPNFAFE |
| Ga0307317_101922642 | 3300028720 | Soil | MHDTTALVRPASAYNPADNPRFPKLHRRFPTVAYLRRHARR |
| Ga0307317_102969132 | 3300028720 | Soil | MHDTTALARPASPYNPADNPRFSALHRRFPTVAYLRRHARRQVPKFAF |
| Ga0307299_102683421 | 3300028793 | Soil | MHDTTAVTRPNVTIYTPADNPRFPNLHRRFPTVAYLRRHARRKLPHFAFEYCD |
| Ga0308197_101634811 | 3300031093 | Soil | MHDTTALVRPASAYNPADNPRFPKLHRRFPTVAYLRRHACRHV |
| Ga0307497_101756092 | 3300031226 | Soil | MHDTTALVRPASVYNPADNPRFPKLHRRFPTVAYLRR |
| Ga0170824_1283767641 | 3300031231 | Forest Soil | MHDTTALVRPASVYNPADNPRFPKLHRRFPTVAYLRRHARRQVP |
| Ga0170819_160975591 | 3300031469 | Forest Soil | MHDTTALVRPASVYNPADNPRFPKLHRRFPTVAYLRRHA |
| Ga0318515_107771712 | 3300031572 | Soil | MQDTTALVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRHVPRFAFEY |
| Ga0318574_102235021 | 3300031680 | Soil | MHDTTALARSAANDYTPADNPRFVKLHRRFPTVAYLRRHARRQVPSFAFEYM |
| Ga0318572_106848841 | 3300031681 | Soil | MQDTTALVRPAAKGYTPADNPRFLKLHRRFPTILYLRQHARRHVPSFAFEY |
| Ga0318560_103164161 | 3300031682 | Soil | MQDTTALVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRHVP |
| Ga0307469_113391251 | 3300031720 | Hardwood Forest Soil | QETTAVVEPAAKIYTPADNARFAQLHRRFPTVAYLRRHARRKLPHFAFE |
| Ga0318546_103722792 | 3300031771 | Soil | MHDTTALARSAGHAYTPADNSRFAGLHRRFPTTAYLRRHAPRHGPR |
| Ga0318552_100983051 | 3300031782 | Soil | MHDTTALAPPTIADYTPADNPRFVRLHRRFPTVAY |
| Ga0318529_103367772 | 3300031792 | Soil | MHDTTALVRPAASDYTPADNPRFVKLYRRFPTVAYLRRHARRHVPRFAFEYMD |
| Ga0318548_104122582 | 3300031793 | Soil | MDDRTALVRPVANDYTPTDNPRFAGLHRRFPTIAYLRRHARRHLPRFAFE |
| Ga0318550_102287221 | 3300031797 | Soil | MHDTTALAPPTIADYTPADNPRFVRLHRRFPTVAYLRRHAS |
| Ga0318567_100624291 | 3300031821 | Soil | MHDTTALAPPTIADYTPADNPRFVRLHRRFPTVAYL |
| Ga0318499_100252373 | 3300031832 | Soil | MQDTTALVRPAARDYTPADNPRFVKLHRRFPTVAYLRRHARRH |
| Ga0306925_103515551 | 3300031890 | Soil | MHDTTALDRSAGTAYTPAENPRFPGLHRRFPTTAYLRRHA |
| Ga0306925_113993861 | 3300031890 | Soil | MAGKKALMHDTTALAPPTVADYTPADNPRFVRLHRRFPTVAYLRRHA |
| Ga0306925_121905112 | 3300031890 | Soil | MDDRTALVRPVANDYTPTDNPRFAGLHRRFPTIAYLRRHARRHL |
| Ga0318536_105248521 | 3300031893 | Soil | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAYLRRHARRNVPSFAFEYMD |
| Ga0310912_112704331 | 3300031941 | Soil | MDDRTALVRPAANDYTPADNPRFAGLHRRFPTIAYLRRHARR |
| Ga0306926_127407091 | 3300031954 | Soil | MHDTTALAPPTVADYTPADNPRFVRLHRRFPTVAYLRRHARR |
| Ga0306922_120294271 | 3300032001 | Soil | MAGKKALIHDTTALATPTVADYTPADNPRFVRLHRRFPTVAYLRRHARRHVPRFAF |
| Ga0318556_100872573 | 3300032043 | Soil | MHDTTALVRPAASDYTPADNPRFVKLYRRFPTVAYP |
| Ga0318570_103687241 | 3300032054 | Soil | MQDTTALVRPAAKGYTPADNPRFLKLHRRFPTILYLR |
| Ga0318504_104686642 | 3300032063 | Soil | MHDTTALVRPAANDYTPADNPRFVKLHRRFPTVAY |
| Ga0306924_1000881313 | 3300032076 | Soil | MHDTTALSRPTAKDYTPADNPRFTKLHRRFPTVADLR |
| Ga0307471_1010673951 | 3300032180 | Hardwood Forest Soil | MHDTTALVRSAASDYTPADNPRFLKLHRRFPTIAYLRQHARSHVPS |
| Ga0307472_1024438172 | 3300032205 | Hardwood Forest Soil | MHDTTALARPNARIYLPADNPRFAALHRRFPTVAYLRRQARRKLPHFAFEYCD |
| Ga0326723_0182570_2_133 | 3300034090 | Peat Soil | MHDTTAVTKPNVKVYTPADNPRYVKLHRRFPTVPYLRRHARRNL |
| Ga0364929_0073313_914_1057 | 3300034149 | Sediment | MDDTTALPRAAAGDYTPADNPRFIKLHRRFPTIDYLRRQARRHVPSFA |
| ⦗Top⦘ |