


| Basic Information | |
|---|---|
| Family ID | F086888 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGEKVSQRRWSK |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.57 % |
| % of genes near scaffold ends (potentially truncated) | 52.73 % |
| % of genes from short scaffolds (< 2000 bps) | 73.64 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (44.545 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF04986 | Y2_Tnp | 22.73 |
| PF14319 | Zn_Tnp_IS91 | 6.36 |
| PF00069 | Pkinase | 4.55 |
| PF13495 | Phage_int_SAM_4 | 4.55 |
| PF04185 | Phosphoesterase | 2.73 |
| PF02371 | Transposase_20 | 1.82 |
| PF13466 | STAS_2 | 1.82 |
| PF00111 | Fer2 | 1.82 |
| PF03449 | GreA_GreB_N | 0.91 |
| PF13426 | PAS_9 | 0.91 |
| PF01569 | PAP2 | 0.91 |
| PF00856 | SET | 0.91 |
| PF13620 | CarboxypepD_reg | 0.91 |
| PF03544 | TonB_C | 0.91 |
| PF02311 | AraC_binding | 0.91 |
| PF08327 | AHSA1 | 0.91 |
| PF00589 | Phage_integrase | 0.91 |
| PF13744 | HTH_37 | 0.91 |
| PF10503 | Esterase_PHB | 0.91 |
| PF05988 | DUF899 | 0.91 |
| PF01638 | HxlR | 0.91 |
| PF01695 | IstB_IS21 | 0.91 |
| PF01272 | GreA_GreB | 0.91 |
| PF13650 | Asp_protease_2 | 0.91 |
| PF16285 | DUF4931 | 0.91 |
| PF04079 | SMC_ScpB | 0.91 |
| PF07077 | DUF1345 | 0.91 |
| PF02517 | Rce1-like | 0.91 |
| PF07719 | TPR_2 | 0.91 |
| PF14329 | DUF4386 | 0.91 |
| PF12161 | HsdM_N | 0.91 |
| PF13424 | TPR_12 | 0.91 |
| PF12704 | MacB_PCD | 0.91 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF07883 | Cupin_2 | 0.91 |
| PF07677 | A2M_recep | 0.91 |
| PF12833 | HTH_18 | 0.91 |
| PF00561 | Abhydrolase_1 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 18.18 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 2.73 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 1.82 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.82 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 0.91 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.91 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.91 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.91 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.91 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.27 % |
| Unclassified | root | N/A | 2.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10111139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300001471|JGI12712J15308_10009194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2690 | Open in IMG/M |
| 3300001593|JGI12635J15846_10122040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1839 | Open in IMG/M |
| 3300001661|JGI12053J15887_10046557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2431 | Open in IMG/M |
| 3300002911|JGI25390J43892_10006659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2619 | Open in IMG/M |
| 3300003370|JGI26337J50220_1003119 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300004091|Ga0062387_101058395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300004092|Ga0062389_101119418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300005172|Ga0066683_10540980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300005180|Ga0066685_10503274 | Not Available | 839 | Open in IMG/M |
| 3300005445|Ga0070708_101638773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300005450|Ga0066682_10055921 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
| 3300005450|Ga0066682_10122385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1646 | Open in IMG/M |
| 3300005558|Ga0066698_10040827 | All Organisms → cellular organisms → Bacteria | 2882 | Open in IMG/M |
| 3300005569|Ga0066705_10361195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300005591|Ga0070761_10398169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300005921|Ga0070766_10088347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1816 | Open in IMG/M |
| 3300005921|Ga0070766_11026611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300006796|Ga0066665_10567879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300006797|Ga0066659_10962224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300006854|Ga0075425_100707909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300006893|Ga0073928_10003159 | All Organisms → cellular organisms → Bacteria | 26450 | Open in IMG/M |
| 3300006893|Ga0073928_10428427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300006893|Ga0073928_10484596 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300007819|Ga0104322_134345 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300009038|Ga0099829_10050230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3088 | Open in IMG/M |
| 3300009038|Ga0099829_10090564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2361 | Open in IMG/M |
| 3300009038|Ga0099829_11380474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300009089|Ga0099828_10299137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
| 3300009089|Ga0099828_11425476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300009520|Ga0116214_1161686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300009700|Ga0116217_10115120 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300010379|Ga0136449_104312951 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010860|Ga0126351_1200667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300011270|Ga0137391_10098299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2534 | Open in IMG/M |
| 3300012096|Ga0137389_10004879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8523 | Open in IMG/M |
| 3300012096|Ga0137389_10388785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
| 3300012189|Ga0137388_10005116 | All Organisms → cellular organisms → Bacteria | 8719 | Open in IMG/M |
| 3300012202|Ga0137363_10144523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1862 | Open in IMG/M |
| 3300012202|Ga0137363_10698479 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300012203|Ga0137399_10998053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300012205|Ga0137362_10186932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1781 | Open in IMG/M |
| 3300012205|Ga0137362_11656396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012206|Ga0137380_10435270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300012349|Ga0137387_10547058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 840 | Open in IMG/M |
| 3300012349|Ga0137387_10829855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300012356|Ga0137371_10530920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 907 | Open in IMG/M |
| 3300012362|Ga0137361_10208095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1771 | Open in IMG/M |
| 3300012582|Ga0137358_10310915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| 3300012582|Ga0137358_10329910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300012683|Ga0137398_10098811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1832 | Open in IMG/M |
| 3300012685|Ga0137397_10624121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300012917|Ga0137395_10680030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300012918|Ga0137396_10166439 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300012922|Ga0137394_10074122 | All Organisms → cellular organisms → Bacteria | 2840 | Open in IMG/M |
| 3300012922|Ga0137394_10830879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300012923|Ga0137359_10506791 | Not Available | 1064 | Open in IMG/M |
| 3300012925|Ga0137419_10325595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1182 | Open in IMG/M |
| 3300012925|Ga0137419_11017042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300012927|Ga0137416_10590027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300012929|Ga0137404_10541463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300012929|Ga0137404_10867303 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300012929|Ga0137404_11940156 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012930|Ga0137407_11777503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300015053|Ga0137405_1350816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1984 | Open in IMG/M |
| 3300015241|Ga0137418_10800434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300015242|Ga0137412_10038583 | All Organisms → cellular organisms → Bacteria | 3901 | Open in IMG/M |
| 3300015245|Ga0137409_10050878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3935 | Open in IMG/M |
| 3300015245|Ga0137409_10270702 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300015264|Ga0137403_10014903 | All Organisms → cellular organisms → Bacteria | 8457 | Open in IMG/M |
| 3300015264|Ga0137403_10143945 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300018006|Ga0187804_10387868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300018431|Ga0066655_10255380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300019887|Ga0193729_1198915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300020140|Ga0179590_1064787 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300020583|Ga0210401_11013760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300021088|Ga0210404_10796481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300021403|Ga0210397_10521308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300021420|Ga0210394_10707914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella pectinivorans | 882 | Open in IMG/M |
| 3300021476|Ga0187846_10002584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9822 | Open in IMG/M |
| 3300022557|Ga0212123_10002687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 40867 | Open in IMG/M |
| 3300022557|Ga0212123_10305283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300025898|Ga0207692_10583792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300026310|Ga0209239_1012202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4509 | Open in IMG/M |
| 3300026360|Ga0257173_1033512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300026369|Ga0257152_1030577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300026532|Ga0209160_1033427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3206 | Open in IMG/M |
| 3300026557|Ga0179587_10093846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1805 | Open in IMG/M |
| 3300027050|Ga0209325_1011300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300027603|Ga0209331_1006278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3212 | Open in IMG/M |
| 3300027604|Ga0208324_1143626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300027635|Ga0209625_1059709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300027681|Ga0208991_1066994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300027684|Ga0209626_1007107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2528 | Open in IMG/M |
| 3300027727|Ga0209328_10017722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2166 | Open in IMG/M |
| 3300027737|Ga0209038_10050120 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300027767|Ga0209655_10010130 | All Organisms → cellular organisms → Bacteria | 3194 | Open in IMG/M |
| 3300027846|Ga0209180_10659289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300027862|Ga0209701_10392535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300027889|Ga0209380_10478251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300027903|Ga0209488_10033317 | All Organisms → cellular organisms → Bacteria | 3758 | Open in IMG/M |
| 3300027908|Ga0209006_10833305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300028047|Ga0209526_10342540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300028536|Ga0137415_10143581 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
| 3300028536|Ga0137415_10412583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
| 3300030707|Ga0310038_10132485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300031708|Ga0310686_109680673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1417 | Open in IMG/M |
| 3300031708|Ga0310686_110991312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2936 | Open in IMG/M |
| 3300031962|Ga0307479_10006496 | All Organisms → cellular organisms → Bacteria | 10740 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 44.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.18% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.45% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101111391 | 3300000567 | Peatlands Soil | VIAADAGLMQIQSWEGAVLRRAETVLQDTRHDTLGTEMGHGEKVSRRLWS* |
| JGI12712J15308_100091943 | 3300001471 | Forest Soil | MQIELWEGAALSGVETVPQGTTLDTVRAEIDYSEKVSQ* |
| JGI12635J15846_101220402 | 3300001593 | Forest Soil | MQIQWCEGAVLSRAETVLQGTTHDTVRAEIEYGEKVS |
| JGI12053J15887_100465573 | 3300001661 | Forest Soil | VVAVDAGAMQIQSWEGAALSDAETVLQGTTHDSVRAEIGYGEKVSQRFRWKKGSV* |
| JGI25390J43892_100066591 | 3300002911 | Grasslands Soil | VVAVDAGPMQIQWWEGAALSRAEIVLQGTRHNTVRAEIDYGEKVSQ* |
| JGI26337J50220_10031192 | 3300003370 | Bog Forest Soil | VVAVDAGAMQIQWWEGAALRRAETVLQGTTQDTVRAEIGYGE* |
| Ga0062387_1010583952 | 3300004091 | Bog Forest Soil | VVAVDAGSMQIESWEGAALSRGETVLQGTTHDTLGAGIGHGEKVSRRLWL |
| Ga0062389_1011194181 | 3300004092 | Bog Forest Soil | VVAVDAGPMRIQWWEGAALNRAETVLQRTTQDTVRAEIGCGEKGPQRRWSKML |
| Ga0066683_105409802 | 3300005172 | Soil | VDAGAMQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGGKVS* |
| Ga0066685_105032742 | 3300005180 | Soil | DAGPMQIQSWEGAVVSRAETVLQGTTHDTVSAEIGFGVNSG* |
| Ga0070708_1016387732 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IQWWEGAALSRAETVLQGTTHDNVRAEIGYGEKVSQRLWLK* |
| Ga0066682_100559216 | 3300005450 | Soil | VVAVDAGPMQIQWWEGAALSGFETVLQGTTQDTVRTEIGYGKKVSQRLWSKKLEE |
| Ga0066682_101223851 | 3300005450 | Soil | VIAVDAGPMQIQSWEGAGLSRVETVLLGTTHERVHAEVGYGEKVS* |
| Ga0066698_100408274 | 3300005558 | Soil | MQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGGKVS* |
| Ga0066705_103611953 | 3300005569 | Soil | MQIQWWEGAALSGFETVLQGTTQDTVRTEIGYGKKVSQRLWSKKLEE |
| Ga0070761_103981692 | 3300005591 | Soil | MWPPVVAVDAGPMQIQWCEGAELSRAETVLQGTTHDTLGTEMGHSEKVS* |
| Ga0070766_100883474 | 3300005921 | Soil | MQIQWWEGAALSDAETVLQGTTQDTVRAEIGYGEKVSQGCSRRS* |
| Ga0070766_110266112 | 3300005921 | Soil | VVAVDADLMQIQSWEGAALSRAEIVLQGTRHDTVRAEIDYG* |
| Ga0066665_105678793 | 3300006796 | Soil | MQIQWWEGAAVRHAETVLQGTTHDTVRAEIGYGEKVSQRLWSKKVE |
| Ga0066659_109622242 | 3300006797 | Soil | MWPPVVAVDAGAMQIQSCEGAVLSRAETVLQGTTHDTVHAEIGYGKKVSRRLWLKKLEEEIGDGEA* |
| Ga0075425_1007079092 | 3300006854 | Populus Rhizosphere | VGAVDAGPMQIQWGEGVALSRVETVLQGTTHDTVHAEVGYGEKVS* |
| Ga0073928_1000315924 | 3300006893 | Iron-Sulfur Acid Spring | VVAVDAGPMQIQLWEGAVLRCAETVPQGTTRDTVRAEIDYGEKVSQ* |
| Ga0073928_104284272 | 3300006893 | Iron-Sulfur Acid Spring | VVAVDAGSMQIQSWEGGALSCAETVLQGTIHGTVCAEIGYGEKVS* |
| Ga0073928_104845962 | 3300006893 | Iron-Sulfur Acid Spring | VVAVDAGPMQIQLWEGAALSRAETVPQGATHDTVRAELDYGEKVSQ* |
| Ga0104322_1343453 | 3300007819 | Permafrost Soil | MQIQLWEGAALSRAETVLQGTTHESVRAEIGYGEKVSQRRWSKKVEE |
| Ga0099829_100502301 | 3300009038 | Vadose Zone Soil | MQIQSWEGAALSRAETVLQGTTHDIVRAEIGYGEKVSQRRWSKKVEEGIG* |
| Ga0099829_100905641 | 3300009038 | Vadose Zone Soil | MWPPVVAVDAGAMQIQSWEGAALSRAETVLQGTTHDTVHAEIGYGKKVSRRLWLKKLEEEIG |
| Ga0099829_113804741 | 3300009038 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTHDTVCAEIGYGEKVSQ* |
| Ga0099828_102991372 | 3300009089 | Vadose Zone Soil | VVAVDAGVMQIQSWEGAALSRAETVLQGTTHDIVRAEIGYGEKVSQRRWSKKVEEGIG* |
| Ga0099828_114254761 | 3300009089 | Vadose Zone Soil | MQIQSREGAALSGAETVLQGTTHDTVRPEISYGEKVSQRRWLKKVE |
| Ga0116214_11616862 | 3300009520 | Peatlands Soil | MQIQSWEGAALSRADTVLQGTTHDTVRAEMGYGEKVS* |
| Ga0116217_101151203 | 3300009700 | Peatlands Soil | AVDAGAMQIQSWEGAALSRADTVLQGTTHDTVRAEMGYGEKVS* |
| Ga0136449_1043129511 | 3300010379 | Peatlands Soil | MQIQLWEGAVWRCVETVLQGTTPDTLGAEIGHGEKVSRRPWSKKLEEEIGLTARH |
| Ga0126351_12006672 | 3300010860 | Boreal Forest Soil | MQIQSWEGAALSRAETVLQGTTHDTVRAEIGYGEKVSQRLWSKKLD |
| Ga0137391_100982991 | 3300011270 | Vadose Zone Soil | WPPVVAVDAGPMQIQLCEGAVLSRAETVLQGTTHDTVRAEIGYGEKVS* |
| Ga0137389_100048799 | 3300012096 | Vadose Zone Soil | MQIQLCEGAVLSRAETVLQGTTHDTVRAEIGYGEKVS* |
| Ga0137389_103887852 | 3300012096 | Vadose Zone Soil | MQIQSWEGAALSGAETVLQGTTHNGVRAEVGYGEKVSQRLWSKKVEEGIGLTARHRDA |
| Ga0137388_100051168 | 3300012189 | Vadose Zone Soil | MQIQSWEGAALSGAETVLQGMAHDTVRGEIGYGEKVSQRLWPKKVEEGIGLAARH |
| Ga0137363_101445235 | 3300012202 | Vadose Zone Soil | MQIQSWEGAALSGAETVLQGTTHDTVRAEIGYGEKVSQRRWLKKVEE |
| Ga0137363_106984791 | 3300012202 | Vadose Zone Soil | MQIQSWEGAALSRAETVLQGAAHDTVRAEIGYGEKVSQRR* |
| Ga0137399_109980532 | 3300012203 | Vadose Zone Soil | AGAMQIQSWEGAALSRAETVLQGTTHDTVRAEIG* |
| Ga0137362_101869322 | 3300012205 | Vadose Zone Soil | MQIQLCEGAVLSRAETVLQGTTHDTVHAEIGYGKKVSRRLWLKKLEEEIGLTARHR |
| Ga0137362_116563962 | 3300012205 | Vadose Zone Soil | MQIQSWEGAALSRAETVLQGTTHGTVRAEIGYGEKVSRRLWSKKLEEG |
| Ga0137380_104352701 | 3300012206 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTQDTVGAEIGYGEKVRKDCGRRS* |
| Ga0137387_105470581 | 3300012349 | Vadose Zone Soil | MQIQWWGGAALSRGETVLQGTTQDIVRAEIGYGEKVSQRLWSKKLEEGIG |
| Ga0137387_108298552 | 3300012349 | Vadose Zone Soil | PPVVAVDAGPMQIQWWEGAALSRAEIVLQGTRHNTVRAEIDYGEKVSQ* |
| Ga0137371_105309201 | 3300012356 | Vadose Zone Soil | MQIQSWEGATLSRAETVLQGTTHDTVRAEIGYGEKVSQRLCLKKLEEGIG |
| Ga0137361_102080951 | 3300012362 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTQDTVRAEIGYGEKVSQRLWLRKLEEG |
| Ga0137358_103109151 | 3300012582 | Vadose Zone Soil | MQIQSWEGAALSGAETVLPGTTHDTVRAEIGYGEKVSQRRWLKKVEEAIGLTARH |
| Ga0137358_103299101 | 3300012582 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTQDTVRAEIGYGEKVSQRL |
| Ga0137398_100988112 | 3300012683 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTHDTVRVEIGYGEKVSQ* |
| Ga0137397_106241211 | 3300012685 | Vadose Zone Soil | MQIQWWDGAALRRAETVLPSTTHDTVRAEIGYGEKVSQRLW |
| Ga0137395_106800302 | 3300012917 | Vadose Zone Soil | VVAVDAGPMQIQSWEGAAFRRAETVPQGTTHDTLRSEIGHGEKVSR |
| Ga0137396_101664393 | 3300012918 | Vadose Zone Soil | WTWPPVVAVDAGPMQIQWWEGAALSRAEIVLQGTRHNTVRAEIDYGEKVSQ* |
| Ga0137394_100741226 | 3300012922 | Vadose Zone Soil | MQIQSWEGAALSGAETVLQGTTHDTVRAEIGYGEKVSQRRWLKKVEEAIGLTARH |
| Ga0137394_108308792 | 3300012922 | Vadose Zone Soil | LPEFLWWEGAALRRAETVLQGTTHDTVRAEIGFGEKVSQRLWSKKVE |
| Ga0137359_105067911 | 3300012923 | Vadose Zone Soil | MQIQSWEGAALSRAETVLQSTTHDTVRAEIGYGEKVSQRLWSKKVEEG |
| Ga0137419_103255952 | 3300012925 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGEKVSQRRWSK |
| Ga0137419_110170421 | 3300012925 | Vadose Zone Soil | MQIQSWEGAALSGAETVLPGTTHDTVRAEIGYGEKVSQRRWLKKVEEAIGLTARHRDAE |
| Ga0137416_105900271 | 3300012927 | Vadose Zone Soil | MQIQSREGAALSGAETVLQGTTHDTVRAEIGYGEK |
| Ga0137404_105414632 | 3300012929 | Vadose Zone Soil | VAVDAGAMQIQSWEGAALSRAETVLQGTTHDTVCVEIGYGEKVSQDCG* |
| Ga0137404_108673031 | 3300012929 | Vadose Zone Soil | MQIQSCEGAVLSRAETVLQGTTHDTVRAEIGYGEKVSRRLWSKKLEEGIDWATRRSGTGR |
| Ga0137404_119401561 | 3300012929 | Vadose Zone Soil | MQIQSWEGAALSRAETVLQGTTHDTVRAEIGYGEKVLWSKK |
| Ga0137407_117775032 | 3300012930 | Vadose Zone Soil | MQIQWWEGAALSRVETVLQGTTHNTVRAEIGYGGKVS* |
| Ga0137405_13508161 | 3300015053 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGEKYCGRRSWKKESV* |
| Ga0137418_108004341 | 3300015241 | Vadose Zone Soil | WTWPPVVAVDAGAMQIQSWEGAALSRAETVLQGTTHDTVRAEIG* |
| Ga0137412_100385832 | 3300015242 | Vadose Zone Soil | MQIQSWEGAALSRAETVLQGTTHDTVCAEIGYGEKVSQ* |
| Ga0137409_100508785 | 3300015245 | Vadose Zone Soil | VVAVDAGAMQIQWWEGAALSRAETVLQGTTHDTVCAEIGYGEKVSQ* |
| Ga0137409_102707021 | 3300015245 | Vadose Zone Soil | MQIQSWEGAALSCAETVLQGTTHDTVRAEIGYGEKVSQRRW |
| Ga0137403_100149031 | 3300015264 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTHDTVCVEIGYGEKVSQ* |
| Ga0137403_101439453 | 3300015264 | Vadose Zone Soil | MQIQSWEGAALSRAEAVLQGTTHDTVRAEIGYGEKVLWSKK |
| Ga0187804_103878682 | 3300018006 | Freshwater Sediment | MQIQSWEGAALSRAETVLRGTTHDTVRAEIGYGEKV |
| Ga0066655_102553802 | 3300018431 | Grasslands Soil | MQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGGKVS |
| Ga0193729_11989152 | 3300019887 | Soil | WEGAALSGAETVLQATTHDSVRAEIGYGEKVSQRLWWKKGSV |
| Ga0179590_10647871 | 3300020140 | Vadose Zone Soil | MQIQWCEGAVLSRAETVLQGTTHDTVHAEIGYGKKVSRRLWLKKLEEEIGLTARQAVALM |
| Ga0210401_110137601 | 3300020583 | Soil | VVAVDAGALQIQWWEAALSRAETVLQGRAHDTVRAESGCGEKGPQGL |
| Ga0210404_107964812 | 3300021088 | Soil | MQIQWWEGAALSRTETVLQGTTPDTVRAEIGYGEKVSQRLWSKKLEEEIALTARHRD |
| Ga0210397_105213082 | 3300021403 | Soil | MQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGEKVSQRLWSKKLEEE |
| Ga0210394_107079141 | 3300021420 | Soil | VVAVDAGPMQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGEKVSQRLWSKKLEEEIA |
| Ga0187846_100025843 | 3300021476 | Biofilm | VVAVEAGPMEIQSWEGAGLRRGESVLQGKTQDTVRAEMGYHEK |
| Ga0212123_1000268711 | 3300022557 | Iron-Sulfur Acid Spring | MQIQLWEGAVLRCAETVPQGTTRDTVRAEIDYGEKVSQ |
| Ga0212123_103052832 | 3300022557 | Iron-Sulfur Acid Spring | VVAVDAGPMQIQLWEGAALSRAETVPQGATHDTVRAELDYGEKVSQ |
| Ga0207692_105837921 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MQIQWCEGAVLSRAETVLQGTTHDTVRAEIGYGEKVSRRL |
| Ga0209239_10122023 | 3300026310 | Grasslands Soil | MQIQWWEGAALSRAEIVLQGTRHNTVRAEIDYGEKVSQ |
| Ga0257173_10335121 | 3300026360 | Soil | MQIQWWEGAALSRAETVLQGTTHDTVCAEIGYGEKVSQ |
| Ga0257152_10305772 | 3300026369 | Soil | VVAVDAGAMQIQSWEGAALSRAETVLQGTTHDTVCAEIG |
| Ga0209160_10334272 | 3300026532 | Soil | VDAGAMQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGGKVS |
| Ga0179587_100938461 | 3300026557 | Vadose Zone Soil | MQIQSWEGAALSRAETVLQGTTHDTVCAEIGYGEKVSQ |
| Ga0209325_10113002 | 3300027050 | Forest Soil | MQIQSWEGAALSRAEAVLQGTTHDTVRAEIGYGEKVSQRRWSKKVEEGIGLTARHRDAQW |
| Ga0209331_10062783 | 3300027603 | Forest Soil | MQIQSWEGAALSGAETVLQGTTHDSVRAEIGYGEKVSQRLWWKKGSI |
| Ga0208324_11436261 | 3300027604 | Peatlands Soil | MQIQSWEGAALSRADTVLQGTTHDTVRAEMGYGEKVS |
| Ga0209625_10597092 | 3300027635 | Forest Soil | MQIQSWEGAALSGAETVLQGTTHDTVRAEIGYGEKVSQRRWSKKVEEGSV |
| Ga0208991_10669942 | 3300027681 | Forest Soil | MQIQSWEGAALSDAETVLQGTTHDSVRAEIGYGEKVSQRFRWKKGSV |
| Ga0209626_10071072 | 3300027684 | Forest Soil | MQIQSWEGAALSRAETVLQGTTHDSVRAEIGYGEKVSQRRWSKKVEEGIGLTAR |
| Ga0209328_100177221 | 3300027727 | Forest Soil | VVAADAGPMQIQWWEGAALRRAKTVLQGRTQDTVGAEIGYG |
| Ga0209038_100501202 | 3300027737 | Bog Forest Soil | VVAVDAGAMQIQWWEGAALSRAETVLQGTTQDTVRAEIGYGE |
| Ga0209655_100101302 | 3300027767 | Bog Forest Soil | VVAVDAGAMQIQWWEGAALRRAETVLQGTTQDTVRAEIGYGE |
| Ga0209656_100474401 | 3300027812 | Bog Forest Soil | GKAVWTWPRVIAVDADLMQIQSWEGAVSRCAETVLPNAKHDTMEE |
| Ga0209180_106592892 | 3300027846 | Vadose Zone Soil | MQIQSWEGAALSRAETVLQGTTHDIVRAEIGYGEKVSQRRWSKKVEEGIG |
| Ga0209701_103925352 | 3300027862 | Vadose Zone Soil | VVAVDAGVMQIQSWEGAALSRAETVLQGTTHDIVRAEIGYGEKVSQRRWSKKVEEGIG |
| Ga0209380_104782512 | 3300027889 | Soil | MQIQWWEGAALSDAETVLQGTTQDTVRAEIGYGEKVSQGCSRRS |
| Ga0209488_100333171 | 3300027903 | Vadose Zone Soil | MQIQPWEGAALSAAETVLQGTTHDTVRAEIGYGEKVSQRR |
| Ga0209006_108333052 | 3300027908 | Forest Soil | VVAVDAGPMQIELWEGAALSGVETVPQGTTLDTVRAEIDYSEKVSQ |
| Ga0209526_103425401 | 3300028047 | Forest Soil | DAGAMQIQSWEGAALSGAETVLQGTTHDSVRAEIGYGEKVSQRLWWKKGSI |
| Ga0137415_101435811 | 3300028536 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTQDTVRAEIGYGEKVSQRLWSKKLEEGIGLTAGHRDAE |
| Ga0137415_104125832 | 3300028536 | Vadose Zone Soil | MQIQWWEGAALSRAETVLQGTTQDTVRTEIGYGKKVSQRLWSKKLEEGIGLTAGHRDAE |
| Ga0310038_101324852 | 3300030707 | Peatlands Soil | MQIQSWEGAALSRAETVLQGTTHDTVRAEMGYGEKVS |
| Ga0310686_1096806732 | 3300031708 | Soil | VVAVDAGPMQIQWWEGAALSRAETVLQGTTHDTVRAEIGYGEKGSQRLWLK |
| Ga0310686_1109913126 | 3300031708 | Soil | MQIQWWKGAALSRTETVLQGTTPDTVRAEIGYGEKVSQRLWSKKLEEGIGLTARH |
| Ga0307479_100064963 | 3300031962 | Hardwood Forest Soil | LDVAARVAVDAGAMQIQSWEGAVLSGAEAVLQGTTHGSVRAEIGYGEKISQRLWRKKGSV |
| ⦗Top⦘ |