


| Basic Information | |
|---|---|
| Family ID | F086876 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VVYAMSHQAVTDVWVHGRPVVRGQRLATLDQGGLMERVRALTFDWRPA |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 89.09 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.79% β-sheet: 19.74% Coil/Unstructured: 64.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02230 | Abhydrolase_2 | 35.45 |
| PF00005 | ABC_tran | 22.73 |
| PF00221 | Lyase_aromatic | 11.82 |
| PF00583 | Acetyltransf_1 | 7.27 |
| PF02621 | VitK2_biosynth | 5.45 |
| PF00459 | Inositol_P | 2.73 |
| PF09084 | NMT1 | 1.82 |
| PF00291 | PALP | 1.82 |
| PF13458 | Peripla_BP_6 | 1.82 |
| PF00561 | Abhydrolase_1 | 1.82 |
| PF04679 | DNA_ligase_A_C | 1.82 |
| PF00881 | Nitroreductase | 0.91 |
| PF02738 | MoCoBD_1 | 0.91 |
| PF13673 | Acetyltransf_10 | 0.91 |
| PF02737 | 3HCDH_N | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 11.82 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 5.45 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.82 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.82 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.82 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.91 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.91 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.91 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.91 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.18 % |
| Unclassified | root | N/A | 21.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004024|Ga0055436_10002964 | All Organisms → cellular organisms → Bacteria | 3146 | Open in IMG/M |
| 3300004114|Ga0062593_102284703 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300004479|Ga0062595_101741960 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005178|Ga0066688_10148870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1465 | Open in IMG/M |
| 3300005186|Ga0066676_10080178 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300005186|Ga0066676_10109422 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300005406|Ga0070703_10545575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005439|Ga0070711_100101617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2093 | Open in IMG/M |
| 3300005445|Ga0070708_101260485 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005446|Ga0066686_10266134 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300005471|Ga0070698_102212595 | Not Available | 503 | Open in IMG/M |
| 3300005526|Ga0073909_10152741 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005536|Ga0070697_100447625 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005544|Ga0070686_100549958 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300005545|Ga0070695_100482971 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005549|Ga0070704_100027910 | All Organisms → cellular organisms → Bacteria | 3749 | Open in IMG/M |
| 3300005554|Ga0066661_10728993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300005554|Ga0066661_10888984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300005617|Ga0068859_100380121 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300005719|Ga0068861_102272025 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005873|Ga0075287_1061068 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006796|Ga0066665_11393424 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006844|Ga0075428_102088261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300006852|Ga0075433_11765283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300006904|Ga0075424_101882567 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009012|Ga0066710_101700743 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300009038|Ga0099829_10818962 | Not Available | 773 | Open in IMG/M |
| 3300009088|Ga0099830_10823923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300009090|Ga0099827_11303118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300009101|Ga0105247_11292754 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009162|Ga0075423_13089456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300009553|Ga0105249_10996528 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300009553|Ga0105249_12424789 | Not Available | 597 | Open in IMG/M |
| 3300009678|Ga0105252_10553476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 531 | Open in IMG/M |
| 3300009792|Ga0126374_11786136 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010043|Ga0126380_10539495 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300010048|Ga0126373_11201746 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300010358|Ga0126370_11975441 | Not Available | 569 | Open in IMG/M |
| 3300010359|Ga0126376_11450945 | Not Available | 713 | Open in IMG/M |
| 3300010359|Ga0126376_12379439 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010362|Ga0126377_10063816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3253 | Open in IMG/M |
| 3300010391|Ga0136847_13410978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1058 | Open in IMG/M |
| 3300010397|Ga0134124_11341480 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010398|Ga0126383_13504667 | Not Available | 512 | Open in IMG/M |
| 3300012035|Ga0137445_1076982 | Not Available | 670 | Open in IMG/M |
| 3300012096|Ga0137389_10111021 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300012201|Ga0137365_10017729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5560 | Open in IMG/M |
| 3300012351|Ga0137386_10871666 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012353|Ga0137367_11170533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300012362|Ga0137361_10471797 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300012363|Ga0137390_11285120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300012922|Ga0137394_10482671 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300012922|Ga0137394_10503043 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300012971|Ga0126369_11580532 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300014873|Ga0180066_1106135 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300014883|Ga0180086_1167881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300015264|Ga0137403_11268475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300015372|Ga0132256_102752914 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300017999|Ga0187767_10368042 | Not Available | 510 | Open in IMG/M |
| 3300018027|Ga0184605_10448074 | Not Available | 569 | Open in IMG/M |
| 3300018029|Ga0187787_10183607 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300018031|Ga0184634_10082797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1380 | Open in IMG/M |
| 3300018079|Ga0184627_10628237 | Not Available | 536 | Open in IMG/M |
| 3300018429|Ga0190272_10526641 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300018431|Ga0066655_10088964 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300019487|Ga0187893_10106790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2439 | Open in IMG/M |
| 3300019882|Ga0193713_1174505 | Not Available | 563 | Open in IMG/M |
| 3300019886|Ga0193727_1081699 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300020150|Ga0187768_1004808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2716 | Open in IMG/M |
| 3300021090|Ga0210377_10338621 | Not Available | 910 | Open in IMG/M |
| 3300021333|Ga0210324_1115617 | Not Available | 602 | Open in IMG/M |
| 3300025164|Ga0209521_10365933 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300025165|Ga0209108_10197015 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300025289|Ga0209002_10330415 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300025905|Ga0207685_10354610 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300025912|Ga0207707_10522540 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300025917|Ga0207660_10458554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1031 | Open in IMG/M |
| 3300025934|Ga0207686_11803400 | Not Available | 506 | Open in IMG/M |
| 3300025938|Ga0207704_10513297 | Not Available | 968 | Open in IMG/M |
| 3300025961|Ga0207712_11657785 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300025999|Ga0208417_101100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1009 | Open in IMG/M |
| 3300026309|Ga0209055_1299061 | Not Available | 506 | Open in IMG/M |
| 3300026351|Ga0257170_1039618 | Not Available | 646 | Open in IMG/M |
| 3300026508|Ga0257161_1085877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300027646|Ga0209466_1015481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1603 | Open in IMG/M |
| 3300027875|Ga0209283_10426534 | Not Available | 862 | Open in IMG/M |
| 3300027909|Ga0209382_10243399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2045 | Open in IMG/M |
| 3300027909|Ga0209382_10789152 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300028587|Ga0247828_10857541 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300028792|Ga0307504_10255438 | Not Available | 643 | Open in IMG/M |
| 3300028807|Ga0307305_10195761 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300028814|Ga0307302_10437499 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 648 | Open in IMG/M |
| 3300030006|Ga0299907_10146530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1951 | Open in IMG/M |
| 3300030619|Ga0268386_10005978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9134 | Open in IMG/M |
| 3300031229|Ga0299913_10155441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2257 | Open in IMG/M |
| 3300031573|Ga0310915_10357825 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300031720|Ga0307469_11103148 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 746 | Open in IMG/M |
| 3300031740|Ga0307468_100601631 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300031740|Ga0307468_101468453 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031768|Ga0318509_10289859 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300031771|Ga0318546_10169816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1478 | Open in IMG/M |
| 3300031949|Ga0214473_11484590 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300032143|Ga0315292_10172890 | Not Available | 1753 | Open in IMG/M |
| 3300032174|Ga0307470_10559671 | Not Available | 847 | Open in IMG/M |
| 3300032893|Ga0335069_11149670 | Not Available | 853 | Open in IMG/M |
| 3300033433|Ga0326726_10095787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2649 | Open in IMG/M |
| 3300033433|Ga0326726_11283402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300033807|Ga0314866_028763 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300033814|Ga0364930_0152443 | Not Available | 788 | Open in IMG/M |
| 3300034165|Ga0364942_0051135 | Not Available | 1326 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.82% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.82% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.91% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021333 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025999 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055436_100029645 | 3300004024 | Natural And Restored Wetlands | NLLKSVIYAMSPQAITDVWVHGRHVVKDRRLATLDQDALMARVAALTRGWIPA* |
| Ga0062593_1022847031 | 3300004114 | Soil | LLKSVVYAMSPQAVTDAWVHGRAAVRGGRLVTLDQDGLLARVRALTHDWRVA* |
| Ga0062595_1017419602 | 3300004479 | Soil | NVVYAMSHQAVTDVWVHGRPVVRGQRLATMDQGDLMERVRALTAQWRPA* |
| Ga0066688_101488701 | 3300005178 | Soil | PQAVTDVWVHGRPIVQDGRLTTLDQDDLMVRVAALTRGWTSA* |
| Ga0066676_100801781 | 3300005186 | Soil | VYAMSPQAVTDVWVHGHRVVTGQRLATLDQDQLMERVRALTRDWTPA* |
| Ga0066676_101094221 | 3300005186 | Soil | LLKNVVYAMSHQAVTDVWVHGRQVVRSQRLTTLDQDALMERVRALTRDWTPA* |
| Ga0070703_105455751 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | KNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA* |
| Ga0070711_1001016174 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | YAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA* |
| Ga0070708_1012604851 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | FAMSPQAVTDVWVHGQPVIRGGRLATLDQDDLLARVRALTREWRVA* |
| Ga0066686_102661341 | 3300005446 | Soil | NLLKNVVYAMSHQAVTDVWVHGRQVVRSQRLTTLDQHALMERVRALTRDWTPA* |
| Ga0070698_1022125952 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHQAVTDAWVHGRHVLRDQRLTTVDQAALLERVRALTKGWPAG* |
| Ga0073909_101527413 | 3300005526 | Surface Soil | PSLHPPTSLLKSVVYAMSHQAVTDVWVHGRPVVRGQRLATLDQAELMERVRALTRDWRLA |
| Ga0070697_1004476253 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | NLLKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA* |
| Ga0070686_1005499583 | 3300005544 | Switchgrass Rhizosphere | NVVYAMSHQAVTDVWVHGRPVVRGQRLATLDQADLMERVRALTRDWRLG* |
| Ga0070695_1004829711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHQAVTDVWVHGRPVVRGQRLATMDQGDLMERVRALTAQWRPA* |
| Ga0070704_1000279101 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TNLLKNVVYAMSHQAVTDVWVHGRPVVRGQRLATLDQAELMERVRVLTRDWRVA* |
| Ga0066661_107289932 | 3300005554 | Soil | MSPQAVTDVWVHGRRIVQDRRLATLDQETLMARVAALTRGWSAA* |
| Ga0066661_108889842 | 3300005554 | Soil | MSPQAVTDVWVHGRLIVQDRRLATLDQETLMARVAALTRGWSRA* |
| Ga0068859_1003801211 | 3300005617 | Switchgrass Rhizosphere | LLKSVVYAMSHQAVTDVWVHGRAVVRGQRLASLDQAALMERVRALTRDWRLA* |
| Ga0068861_1022720252 | 3300005719 | Switchgrass Rhizosphere | PPTNLLKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA* |
| Ga0075287_10610682 | 3300005873 | Rice Paddy Soil | MSHQAVTDVWVHGRRVVEHQRLALVDQADLLARVRALTRGWTLA* |
| Ga0066665_113934242 | 3300006796 | Soil | DFFYAMSAQAVSDVWVHGRPVVRGQRLVALDQDALMERVRALTREWKPA* |
| Ga0075428_1020882612 | 3300006844 | Populus Rhizosphere | SVVYAMSPQAVTDVWVHGRPVVRGQRLATMEQAALLERVQRLTRDWRP* |
| Ga0075433_117652831 | 3300006852 | Populus Rhizosphere | PQAITDVWVHGRQVVAKQRLTTLDQETLMERVRRLTHGWTSA* |
| Ga0075424_1018825672 | 3300006904 | Populus Rhizosphere | PTRLLKNVVYAMSPQAVTDVWIRGRQVVRSQRLTTLDQDGLMDRVRALTRDWALA* |
| Ga0066710_1017007432 | 3300009012 | Grasslands Soil | VVYAMSHQAVADVWVHGRQVVRSQRLTTLDQGALMERVRALTRDWTPA |
| Ga0099829_108189622 | 3300009038 | Vadose Zone Soil | TDVWVHGRRIVQDRRLATLDQEDLMARVAALTRGWTAA* |
| Ga0099830_108239231 | 3300009088 | Vadose Zone Soil | QAVTDVWVHGRRIVQDRRLATLDQETLMARVAALTRGWSTG* |
| Ga0099827_113031181 | 3300009090 | Vadose Zone Soil | AMSPQAVTDVWVHGRRIVQDRRLATLDQETLMARVATLTRGWSAA* |
| Ga0105247_112927542 | 3300009101 | Switchgrass Rhizosphere | VVYAMSHQAVTDVWVHGRPVVRGQRLATLDQADLMERVRALTRDWRLG* |
| Ga0075423_130894561 | 3300009162 | Populus Rhizosphere | ITDVWVHGSPVVKAQKLATIDQEALMARVRTLTHDWVPA* |
| Ga0105249_109965281 | 3300009553 | Switchgrass Rhizosphere | TMSHQAVTDVWVHGRPIVRGQRLATIEQAELMERVRALTRDWRVA* |
| Ga0105249_124247891 | 3300009553 | Switchgrass Rhizosphere | AMSARAVTDAWVHGRRVVEDRRLVTVDQASLMERVRALTAGWTA* |
| Ga0105252_105534762 | 3300009678 | Soil | VYAMSPQAVSDVWVQGQPVVRGGRLATLDQDALLARVRALTHDWRVA* |
| Ga0126374_117861361 | 3300009792 | Tropical Forest Soil | QAVTDVWVHGRQVVRSQRLTTLDQDGLKERVRRLTRDWALA* |
| Ga0126380_105394952 | 3300010043 | Tropical Forest Soil | VWVRGRQVVRGQRLTTLDQDGLMERVRALTRDWVVV* |
| Ga0126373_112017462 | 3300010048 | Tropical Forest Soil | MSPQAVTDVWVHGRQVVRGERLTGVDQDALMERVRALTRDWRLA* |
| Ga0126370_119754412 | 3300010358 | Tropical Forest Soil | SPQAITDVWVQSRRVVAQQRLTTLDQNELMERVRRLTRAWKAV* |
| Ga0126376_114509451 | 3300010359 | Tropical Forest Soil | ITDVWVHGRQVVSGQKLVTLDQEGLMERVQTLTRNWTRQ* |
| Ga0126376_123794392 | 3300010359 | Tropical Forest Soil | VVYAMSPQAITDVWVHGRRVVAKQRLATLDQETLMERVRRLTHDWAPA* |
| Ga0126377_100638167 | 3300010362 | Tropical Forest Soil | LKSVVYAMSHQAVTDVWVHGRHVVAAQHLVTLDQEDLLARVRALTQDWRVA* |
| Ga0136847_134109781 | 3300010391 | Freshwater Sediment | MSPQAITDVWVHGRQVVKDQRLTLLDQDSLMERVRALTRGWTAG* |
| Ga0134124_113414802 | 3300010397 | Terrestrial Soil | DVWVHGRPVVRGQRLATLDQAHLTERVRALTHDWGLA* |
| Ga0126383_135046671 | 3300010398 | Tropical Forest Soil | PPSSLLKNVVYAMSPQAITDVWVHGRQVVAKQRLSTLDQETLMERVRRLTHGWTAA* |
| Ga0137445_10769821 | 3300012035 | Soil | VVYAMSHQAVTDVWVHGRPVVRGQRLATLDQGGLMERVRALTFDWRPA* |
| Ga0137389_101110211 | 3300012096 | Vadose Zone Soil | PSLHPRSHLLKNVVYAMSHQAVTDVWVHGRPVVRGQRLATQDQAGLMERVRALTFDWKLA |
| Ga0137365_100177299 | 3300012201 | Vadose Zone Soil | YAMSPQAVTDVWVHGRPIVEDGRLTTLDQDDLMVRVAALTRGWTSA* |
| Ga0137386_108716661 | 3300012351 | Vadose Zone Soil | HQAVSDVWVHGRQVVRNQRLATLGREALMERVSRLTRDWTLA* |
| Ga0137367_111705331 | 3300012353 | Vadose Zone Soil | TDVWVHGSQVVKAQKLATLDQETLMERVRKLTDGWAPA* |
| Ga0137361_104717972 | 3300012362 | Vadose Zone Soil | AMSHQAVTDVWVHGRQVVRSQRLTTLDQDALMERVRTLTRDWTPA* |
| Ga0137390_112851202 | 3300012363 | Vadose Zone Soil | AMSPQAVTDVWVHGRRIVQDRRLATLDQEDLMARVAALTRGWTAA* |
| Ga0137394_104826711 | 3300012922 | Vadose Zone Soil | MSPQAITDVWVHGRQVVKGQKLATLDQEALMERVRKLTDGGAPA* |
| Ga0137394_105030433 | 3300012922 | Vadose Zone Soil | VWVHGRQVVRGQRLATMDQAGLMERVRAVTADWRPA* |
| Ga0126369_115805321 | 3300012971 | Tropical Forest Soil | VVYSMSPQAVTDVWVRGRPVVRSQRLTTLDQDELMERVRRLTRDWALA* |
| Ga0180066_11061351 | 3300014873 | Soil | TDVWVHGRQVVKGQRLTTLDQDSLMERVRALTRGWTAA* |
| Ga0180086_11678811 | 3300014883 | Soil | VVYAMSPQAITDVWVHGRQVVKGQKLATLDQEVLMERVRKLSGGWAPA* |
| Ga0137403_112684751 | 3300015264 | Vadose Zone Soil | VVYAMSPQAITDVWVHGSPVVKAQKLATLDQEALMERVRTLTHGWAPA* |
| Ga0132256_1027529142 | 3300015372 | Arabidopsis Rhizosphere | LHPPTKLLKNVVYAMSPQAVTDVWVRGRQVVRSQRLTMLDQDGLMERVRALTRDWSLA* |
| Ga0187767_103680422 | 3300017999 | Tropical Peatland | VVYAMSPQAITDVWVEGRRVVERQRLTTLDQEELLERVRQLTRDWRPDVGC |
| Ga0184605_104480742 | 3300018027 | Groundwater Sediment | HLLKNVVYAMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRALTAEWRPA |
| Ga0187787_101836071 | 3300018029 | Tropical Peatland | YAMSPQAISDVWVHGRPVVLGQRLATIDQSALLARVRALTADWRPA |
| Ga0184634_100827971 | 3300018031 | Groundwater Sediment | AMSPQAVTDVWVHGRAVVRDQRLATVDQAALMERVRALTFDWRPA |
| Ga0184627_106282372 | 3300018079 | Groundwater Sediment | AVTDVWVHGRPVVRDQRLATVDQAALMERVRALTFDWRPA |
| Ga0190272_105266411 | 3300018429 | Soil | MSHQAVTDVWVHGRPVVRGQRLATLDQGGLMERVRALTVDWRPA |
| Ga0066655_100889641 | 3300018431 | Grasslands Soil | TDVWVHGRLIVQDRRLATLDQETLMARVAALTRGWSRA |
| Ga0187893_101067901 | 3300019487 | Microbial Mat On Rocks | NLLKNVVYAMSHQAVTDVWVDGARVVKERRLATLDQTALLEQVRSLTRDWTVA |
| Ga0193713_11745051 | 3300019882 | Soil | MSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRALTAEWRPA |
| Ga0193727_10816993 | 3300019886 | Soil | LKNVVYAMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRALTAEWRPA |
| Ga0187768_10048084 | 3300020150 | Tropical Peatland | AVTDVWVHGRAVVRDRRLASVDQAALMARVRALTADWRPA |
| Ga0210377_103386211 | 3300021090 | Groundwater Sediment | LKNVVYAMSHQAVTDVWVEGRQVVKNQRLTLLDQPDLMERVRRLTQEWKPA |
| Ga0210324_11156172 | 3300021333 | Estuarine | TDVWVHGRHVVRAQKLATLDQDTLIERVRELTRGWAPA |
| Ga0209521_103659331 | 3300025164 | Soil | LHPPTSLLKSVVYAMSPQAITDVWVHGRHVVKDQRVATVDQGALMERVRTLTRGWAPA |
| Ga0209108_101970153 | 3300025165 | Soil | GHPSLHPPTSLLKSVVYAMSPQAITDVWVHGRHVVKDQRLTTVDQGALMERVRTLTRGWAPA |
| Ga0209002_103304153 | 3300025289 | Soil | LHPPTDLLKNVVYSMSPQAITDVWVHGHQVVRNQRLTMLDQAGLMERVRALTRDWKRP |
| Ga0207685_103546102 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SLHPPTNLMKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA |
| Ga0207707_105225403 | 3300025912 | Corn Rhizosphere | QTVTDVWVHGRPVVRGQRLATMDQGDLMERVRALTAQWRPA |
| Ga0207660_104585541 | 3300025917 | Corn Rhizosphere | QAVTDAWVHGRAAVRGGRLVTLDQDGLLARVRALTHDWRVA |
| Ga0207686_118034001 | 3300025934 | Miscanthus Rhizosphere | MKNVVYAMSPQAVTDVWVHGSPVVRAQKLATLDQEALMERVRRLTHGWVPA |
| Ga0207704_105132971 | 3300025938 | Miscanthus Rhizosphere | LLKNVVYAMSHQTVTDVWVHGRPVVRGQRLATMDQGDLMERVRALTAQWRPA |
| Ga0207712_116577852 | 3300025961 | Switchgrass Rhizosphere | QAVTDVWVHGRPVVRGQRLATLDQADLMERVRALTRDWRLG |
| Ga0208417_1011003 | 3300025999 | Rice Paddy Soil | AVTDVWVHGRPVVRAQRLATLEQAALMERVRALTAGWRPA |
| Ga0209055_12990611 | 3300026309 | Soil | VTDVWVHGRLIVQDRRLATLDQETLMARVAALTRGWSRA |
| Ga0257170_10396181 | 3300026351 | Soil | VWVHGRPVVRGQRLATQDQAGLMERVRALTFDWKLA |
| Ga0257161_10858772 | 3300026508 | Soil | KSVVYAMSPQAVTDVWVHGRRIVQDRRLATLDQETLMARVTALTRGWSAA |
| Ga0209466_10154811 | 3300027646 | Tropical Forest Soil | VWVHGQQVVAKQRLATLDQETLMERVRRLTHGWTAA |
| Ga0209283_104265342 | 3300027875 | Vadose Zone Soil | QAVTDVWVHGRPVVRGQRLATQDQAGLMERVRALTFDWKLA |
| Ga0209382_102433991 | 3300027909 | Populus Rhizosphere | SPQAITDVWVHGHPVVRGGRLATLDQNDLLARVRALTGDWRVA |
| Ga0209382_107891521 | 3300027909 | Populus Rhizosphere | RAALVKSVVYAMSPQAVTDVWVHGRPVVRGQRLATMEQAALLERVQRLTRDWRP |
| Ga0247828_108575411 | 3300028587 | Soil | RWPRTHLLKNVVYAMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRALTAEWRPA |
| Ga0307504_102554381 | 3300028792 | Soil | AMSPQAVTDVWVHGRPVVRERRLATVDQAALMERVRALTFDWRPA |
| Ga0307305_101957613 | 3300028807 | Soil | SLHPRTHLLKNVVYAMSHQAVTDVWVHGRQVVRGQRLATMDQAGLMERVRAVTADWRPA |
| Ga0307302_104374991 | 3300028814 | Soil | AVTDVWVHGQLVVRSGRLATLDQDDLLARVRALTREWRVA |
| Ga0299907_101465301 | 3300030006 | Soil | LKNVVYAMSPQAVTDVWVHGRPVVRGQRLATMDQGGLMERVRALTADWRPA |
| Ga0268386_1000597810 | 3300030619 | Soil | AMSHQAVTDVWVHGRPVVRGQRLATLDQAGLMERVRALTTDWQPA |
| Ga0299913_101554414 | 3300031229 | Soil | QAVTDVWVHGRPVVRGQRLATMDQGGLMERVRALTADWRPA |
| Ga0310915_103578252 | 3300031573 | Soil | YAMSPQAITDVWVHGRPVVARQRLATLDQETLMERVRRLTHDWTPA |
| Ga0307469_111031482 | 3300031720 | Hardwood Forest Soil | SPQAVTDVWVHGQQVIRGGRLATLDQDDLLARVRGLTHDWRVA |
| Ga0307468_1006016311 | 3300031740 | Hardwood Forest Soil | VVYAMSPQAVTDVWVHGAQVVKAQKLATIDQEALMERVRTLTHGWAPA |
| Ga0307468_1014684531 | 3300031740 | Hardwood Forest Soil | EHPSLHPQTSLLKSVVYALSHQAVTDVWVHGRPVVRGQRLATLEQAELMERVRALTRDWRLA |
| Ga0318509_102898591 | 3300031768 | Soil | HPPSRLLKNVVYAMSPQAITDVWVHGRPVVARQRLATLDQETLMERVRRLTHDWTPA |
| Ga0318546_101698161 | 3300031771 | Soil | ITDVWVHGRPVVARQRLATLDQETLMERVRRLTHDWTPA |
| Ga0214473_114845901 | 3300031949 | Soil | PTSLLKSIVYAMSPQAVTDVWVHGRPVVRGQRLATLDQAELMERVRALTCDWRLA |
| Ga0315292_101728904 | 3300032143 | Sediment | PQAITDVWVHGRQVVKEQKLATLDQEALMERVGKLTRAWTPA |
| Ga0307470_105596712 | 3300032174 | Hardwood Forest Soil | TDVWVHGTPVVKAQKLATLDQEALMERVRTLTHGWVPA |
| Ga0335069_111496701 | 3300032893 | Soil | VVYAMSPQAITDVWVHGRQVVKGQKLATLDQGALMERVQKLTGSWAPV |
| Ga0326726_100957871 | 3300033433 | Peat Soil | EHPSLHPRTHLLKSVVYAMSPQAVTDVWVHGRPVVRGQRLATLDQAALMARVRALTADWRPA |
| Ga0326726_112834021 | 3300033433 | Peat Soil | MSPQAITDVWVHGRQVVKGQKLTTLDQEALMDRVRKLTSGWAPA |
| Ga0314866_028763_688_846 | 3300033807 | Peatland | PLKSVVYAMSPQAITDVWVHGRRVVEAQRLATMDQDALMERVRTLTKGWSPA |
| Ga0364930_0152443_2_121 | 3300033814 | Sediment | ITDVWVHGRQVVKDQRLTMLDQDSLMERVRALTRGWTAA |
| Ga0364942_0051135_3_185 | 3300034165 | Sediment | PSLHPPTDLLKNVVYAMSPQAITDVWVHGHQVVRNQRLTMLDQAGLMERVRALTRDWKRP |
| ⦗Top⦘ |