


| Basic Information | |
|---|---|
| Family ID | F086873 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNA |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 49.54 % |
| % of genes near scaffold ends (potentially truncated) | 41.82 % |
| % of genes from short scaffolds (< 2000 bps) | 64.55 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (57.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 2.78% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00239 | Resolvase | 7.27 |
| PF13683 | rve_3 | 2.73 |
| PF07883 | Cupin_2 | 2.73 |
| PF00072 | Response_reg | 1.82 |
| PF13432 | TPR_16 | 1.82 |
| PF11149 | DUF2924 | 1.82 |
| PF06037 | DUF922 | 1.82 |
| PF13185 | GAF_2 | 1.82 |
| PF11937 | DUF3455 | 0.91 |
| PF05721 | PhyH | 0.91 |
| PF07992 | Pyr_redox_2 | 0.91 |
| PF12833 | HTH_18 | 0.91 |
| PF13565 | HTH_32 | 0.91 |
| PF00043 | GST_C | 0.91 |
| PF03544 | TonB_C | 0.91 |
| PF08818 | DUF1801 | 0.91 |
| PF03237 | Terminase_6N | 0.91 |
| PF02954 | HTH_8 | 0.91 |
| PF01431 | Peptidase_M13 | 0.91 |
| PF13431 | TPR_17 | 0.91 |
| PF12146 | Hydrolase_4 | 0.91 |
| PF02129 | Peptidase_S15 | 0.91 |
| PF13006 | Nterm_IS4 | 0.91 |
| PF13460 | NAD_binding_10 | 0.91 |
| PF04945 | YHS | 0.91 |
| PF01904 | DUF72 | 0.91 |
| PF07642 | BBP2 | 0.91 |
| PF08534 | Redoxin | 0.91 |
| PF00082 | Peptidase_S8 | 0.91 |
| PF13358 | DDE_3 | 0.91 |
| PF12840 | HTH_20 | 0.91 |
| PF07730 | HisKA_3 | 0.91 |
| PF07690 | MFS_1 | 0.91 |
| PF03413 | PepSY | 0.91 |
| PF13492 | GAF_3 | 0.91 |
| PF07519 | Tannase | 0.91 |
| PF10417 | 1-cysPrx_C | 0.91 |
| PF04377 | ATE_C | 0.91 |
| PF13191 | AAA_16 | 0.91 |
| PF00201 | UDPGT | 0.91 |
| PF00196 | GerE | 0.91 |
| PF08902 | DUF1848 | 0.91 |
| PF13561 | adh_short_C2 | 0.91 |
| PF00149 | Metallophos | 0.91 |
| PF05016 | ParE_toxin | 0.91 |
| PF14417 | MEDS | 0.91 |
| PF13278 | Obsolete Pfam Family | 0.91 |
| PF13439 | Glyco_transf_4 | 0.91 |
| PF11578 | DUF3237 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 7.27 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 7.27 |
| COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 1.82 |
| COG5661 | Predicted secreted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG5664 | Predicted secreted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.91 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.91 |
| COG2935 | Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.91 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.91 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.91 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.91 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.91 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.91 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.27 % |
| Unclassified | root | N/A | 2.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001160|JGI12654J13325_1012631 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300001661|JGI12053J15887_10508293 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300001686|C688J18823_10000117 | All Organisms → cellular organisms → Bacteria | 41434 | Open in IMG/M |
| 3300005171|Ga0066677_10027772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2680 | Open in IMG/M |
| 3300005177|Ga0066690_10003098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7082 | Open in IMG/M |
| 3300005178|Ga0066688_10101146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1761 | Open in IMG/M |
| 3300005187|Ga0066675_10034488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3000 | Open in IMG/M |
| 3300005187|Ga0066675_10166930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1523 | Open in IMG/M |
| 3300005343|Ga0070687_100676335 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005445|Ga0070708_100238337 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300005458|Ga0070681_11416712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 619 | Open in IMG/M |
| 3300005467|Ga0070706_101372713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 647 | Open in IMG/M |
| 3300005518|Ga0070699_101898206 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005529|Ga0070741_10260537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1647 | Open in IMG/M |
| 3300005536|Ga0070697_100572886 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005552|Ga0066701_10003344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6258 | Open in IMG/M |
| 3300005555|Ga0066692_10050482 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300005568|Ga0066703_10011085 | All Organisms → cellular organisms → Bacteria | 4345 | Open in IMG/M |
| 3300005586|Ga0066691_10211044 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300005894|Ga0075270_1037640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300006797|Ga0066659_10011774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4715 | Open in IMG/M |
| 3300006797|Ga0066659_10364840 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300007255|Ga0099791_10018935 | All Organisms → cellular organisms → Bacteria | 2946 | Open in IMG/M |
| 3300007255|Ga0099791_10447229 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300007255|Ga0099791_10607486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 535 | Open in IMG/M |
| 3300007255|Ga0099791_10649433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300007258|Ga0099793_10111516 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300007258|Ga0099793_10341174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 731 | Open in IMG/M |
| 3300007258|Ga0099793_10520382 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300007265|Ga0099794_10059573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1853 | Open in IMG/M |
| 3300007265|Ga0099794_10715002 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300009038|Ga0099829_10033471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3687 | Open in IMG/M |
| 3300009038|Ga0099829_10096641 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300009038|Ga0099829_11325294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 595 | Open in IMG/M |
| 3300009038|Ga0099829_11419986 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009088|Ga0099830_10056673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2785 | Open in IMG/M |
| 3300009090|Ga0099827_11445075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300009090|Ga0099827_11600954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 567 | Open in IMG/M |
| 3300009137|Ga0066709_100043844 | All Organisms → cellular organisms → Bacteria | 4951 | Open in IMG/M |
| 3300009143|Ga0099792_10203606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1127 | Open in IMG/M |
| 3300009143|Ga0099792_10699240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 656 | Open in IMG/M |
| 3300009143|Ga0099792_10765569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 630 | Open in IMG/M |
| 3300010400|Ga0134122_10337827 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300011270|Ga0137391_10137523 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300011271|Ga0137393_10065705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2878 | Open in IMG/M |
| 3300011271|Ga0137393_10983340 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012189|Ga0137388_10607091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1017 | Open in IMG/M |
| 3300012202|Ga0137363_10248381 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300012203|Ga0137399_10299750 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300012203|Ga0137399_11152447 | Not Available | 653 | Open in IMG/M |
| 3300012205|Ga0137362_10014410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5914 | Open in IMG/M |
| 3300012205|Ga0137362_10550837 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012205|Ga0137362_10653740 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300012208|Ga0137376_11215285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 643 | Open in IMG/M |
| 3300012361|Ga0137360_10623493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 924 | Open in IMG/M |
| 3300012361|Ga0137360_10958928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 738 | Open in IMG/M |
| 3300012582|Ga0137358_10013959 | All Organisms → cellular organisms → Bacteria | 5061 | Open in IMG/M |
| 3300012685|Ga0137397_10010823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6350 | Open in IMG/M |
| 3300012685|Ga0137397_10058822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2771 | Open in IMG/M |
| 3300012917|Ga0137395_11058292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300012918|Ga0137396_10016643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4643 | Open in IMG/M |
| 3300012918|Ga0137396_10068336 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300012918|Ga0137396_10382441 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300012918|Ga0137396_10772639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 707 | Open in IMG/M |
| 3300012922|Ga0137394_10012493 | All Organisms → cellular organisms → Bacteria | 6673 | Open in IMG/M |
| 3300012922|Ga0137394_10221337 | Not Available | 1618 | Open in IMG/M |
| 3300012929|Ga0137404_10001618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 14844 | Open in IMG/M |
| 3300012929|Ga0137404_11327384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 663 | Open in IMG/M |
| 3300012930|Ga0137407_10012277 | All Organisms → cellular organisms → Bacteria | 6134 | Open in IMG/M |
| 3300012930|Ga0137407_10619949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1016 | Open in IMG/M |
| 3300012944|Ga0137410_10992067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 715 | Open in IMG/M |
| 3300012944|Ga0137410_11097773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 681 | Open in IMG/M |
| 3300015054|Ga0137420_1089782 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300015054|Ga0137420_1371184 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
| 3300018431|Ga0066655_10943832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 592 | Open in IMG/M |
| 3300018433|Ga0066667_11244178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 649 | Open in IMG/M |
| 3300018468|Ga0066662_10036691 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300019789|Ga0137408_1451226 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300020170|Ga0179594_10006177 | All Organisms → cellular organisms → Bacteria | 3111 | Open in IMG/M |
| 3300024330|Ga0137417_1227664 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300026295|Ga0209234_1025768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2232 | Open in IMG/M |
| 3300026296|Ga0209235_1054676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1899 | Open in IMG/M |
| 3300026297|Ga0209237_1084689 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300026309|Ga0209055_1044408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1947 | Open in IMG/M |
| 3300026322|Ga0209687_1025811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1919 | Open in IMG/M |
| 3300026331|Ga0209267_1046248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1983 | Open in IMG/M |
| 3300026331|Ga0209267_1285520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 553 | Open in IMG/M |
| 3300026333|Ga0209158_1251507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 606 | Open in IMG/M |
| 3300026371|Ga0257179_1057508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 513 | Open in IMG/M |
| 3300026527|Ga0209059_1112844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1062 | Open in IMG/M |
| 3300026529|Ga0209806_1079054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1457 | Open in IMG/M |
| 3300026542|Ga0209805_1063407 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
| 3300027643|Ga0209076_1037773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1356 | Open in IMG/M |
| 3300027655|Ga0209388_1036617 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300027663|Ga0208990_1007158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3706 | Open in IMG/M |
| 3300027667|Ga0209009_1179671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 537 | Open in IMG/M |
| 3300027678|Ga0209011_1016877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2389 | Open in IMG/M |
| 3300027748|Ga0209689_1006798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7969 | Open in IMG/M |
| 3300027748|Ga0209689_1007147 | All Organisms → cellular organisms → Bacteria | 7743 | Open in IMG/M |
| 3300027846|Ga0209180_10000002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 166644 | Open in IMG/M |
| 3300027846|Ga0209180_10000047 | All Organisms → cellular organisms → Bacteria | 61673 | Open in IMG/M |
| 3300027846|Ga0209180_10014118 | All Organisms → cellular organisms → Bacteria | 4169 | Open in IMG/M |
| 3300027846|Ga0209180_10357433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 832 | Open in IMG/M |
| 3300027875|Ga0209283_10016083 | All Organisms → cellular organisms → Bacteria | 4521 | Open in IMG/M |
| 3300027882|Ga0209590_10650650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300028536|Ga0137415_10051859 | All Organisms → cellular organisms → Bacteria | 3976 | Open in IMG/M |
| 3300028536|Ga0137415_10249631 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300032205|Ga0307472_102414716 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032770|Ga0335085_10009750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14453 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 57.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12654J13325_10126312 | 3300001160 | Forest Soil | MRCRYAGCKNRSKGPRFRFLCEKHMKLPKKKQDEVLAKWAAKNAKRE* |
| JGI12053J15887_105082932 | 3300001661 | Forest Soil | MRCRYPGCKNRSKGPRFRFFCEKHIKLPKKEQEAVLAKWAEKSSRSHPA* |
| C688J18823_1000011741 | 3300001686 | Soil | MSCRYPGCKNRSKGPRFKFLCADHLKLPKKEQEAVLAKWAQKNA* |
| Ga0066677_100277724 | 3300005171 | Soil | MRCRYPGCKNRSKGPRFRFFCEEHLKLPKKEQDAALVKWAAKNP* |
| Ga0066690_100030982 | 3300005177 | Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKEQGAALAKWAEKNA* |
| Ga0066688_101011462 | 3300005178 | Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNA* |
| Ga0066675_100344883 | 3300005187 | Soil | MSCRYPGCKNRSKGPRFRFFCEKHLKLPKKEQDAALAKWAQKNT* |
| Ga0066675_101669301 | 3300005187 | Soil | RAGSSKRDMSCRYPGCKDRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAGKTSRLT* |
| Ga0070687_1006763352 | 3300005343 | Switchgrass Rhizosphere | GCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAAKNAKSE* |
| Ga0070708_1002383371 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRCRYPGCKNRSKGPRFRFFCEEHLKLPKKKQDEVLAKWAGKNA* |
| Ga0070681_114167122 | 3300005458 | Corn Rhizosphere | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNAK* |
| Ga0070706_1013727132 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKKA* |
| Ga0070699_1018982062 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRCRYPGCKNRSKGPRFRFFCEKHLKLPKKKQEAALAKWAAKRR |
| Ga0070741_102605373 | 3300005529 | Surface Soil | KKRDMSCRYAGCKNRSKGPRFRFLCVEHLKLPKKKQDEVLAKWAKRA* |
| Ga0070697_1005728861 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | YPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKTG* |
| Ga0066701_100033446 | 3300005552 | Soil | MRCRYPGCKNRSKGPRFRFFCEEHLKLPKKQQDAALVKWAAKNA* |
| Ga0066692_100504822 | 3300005555 | Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKEQGAALAKWTEKNA* |
| Ga0066703_100110855 | 3300005568 | Soil | MRCRYPGCKNRSKGPRFRFFCEEHLKLPKKEQDAALVKWAAKNA* |
| Ga0066691_102110441 | 3300005586 | Soil | KNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNG* |
| Ga0075270_10376403 | 3300005894 | Rice Paddy Soil | MRCRFPGCKNRSKGPRFRFLCDQHLKLPKKEQDAALAKWA |
| Ga0066659_100117746 | 3300006797 | Soil | GSLKRDMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEILAKWAEKNP* |
| Ga0066659_103648401 | 3300006797 | Soil | MRCRYPGCKNRSKGPRFRFLGEEHLKLPKKDQDAALAKWAEKNA* |
| Ga0099791_100189354 | 3300007255 | Vadose Zone Soil | MSCRYPGCTNRSKGPRFRFLCEKHLKLPRKKQDEVLAKWAEKND* |
| Ga0099791_104472291 | 3300007255 | Vadose Zone Soil | MRCRYPGCKNRSKRPLFPFFCEKHLKLPKKKQEAALAKWAKKRRSNA* |
| Ga0099791_106074862 | 3300007255 | Vadose Zone Soil | DMSCRYPGCKNRSKGPRFRFFCEEHLKLPKKKRDEVLAKWVQKNA* |
| Ga0099791_106494331 | 3300007255 | Vadose Zone Soil | AGSLKRDMSCRYPGCKNRSKGPRFRFFCEEHLKLPKKEQDVALAKWAEKNA* |
| Ga0099793_101115162 | 3300007258 | Vadose Zone Soil | MSCRYPGCTNRSKGPRFRFLCEKHLKLPRKKQDEVLAKWAEKNE* |
| Ga0099793_103411743 | 3300007258 | Vadose Zone Soil | CRYPGCKNKSKGPRFRFLCDEHRKLPKKKQDEVLAKAAEKNA* |
| Ga0099793_105203821 | 3300007258 | Vadose Zone Soil | GSLKRDMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNA* |
| Ga0099794_100595733 | 3300007265 | Vadose Zone Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNP* |
| Ga0099794_107150022 | 3300007265 | Vadose Zone Soil | CRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWTGKNG* |
| Ga0099829_100334712 | 3300009038 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCDEHRKLPKKKQAAALAKWAEKNG* |
| Ga0099829_100966412 | 3300009038 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKEQDAVLEKWAQKNG* |
| Ga0099829_113252941 | 3300009038 | Vadose Zone Soil | KNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAKKNA* |
| Ga0099829_114199862 | 3300009038 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCDEHRKLPKKKQEAALAHWAKT* |
| Ga0099830_100566734 | 3300009088 | Vadose Zone Soil | MRCRYPGCKNKSKGPRFRYLCEEHLKLPKKKQDEVLAKAAEKNT* |
| Ga0099827_114450751 | 3300009090 | Vadose Zone Soil | PGCKNRSKGPRFRFLCEEHLNLPRKEQDAALTKWAEKLNRGGP* |
| Ga0099827_116009542 | 3300009090 | Vadose Zone Soil | RFPGCKNRSKGPRFRFFCEEHLKLPKKKQDEVLAKWAEKTS* |
| Ga0066709_1000438447 | 3300009137 | Grasslands Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKRQEEVLAKWAEKNA* |
| Ga0099792_102036061 | 3300009143 | Vadose Zone Soil | YPGCKNRSKGPRFKFLCDEHRKLPKKVQAAALAKWAEKNGKA* |
| Ga0099792_106992401 | 3300009143 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQETVLAKWADKNAAG* |
| Ga0099792_107655692 | 3300009143 | Vadose Zone Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLARWAEKNT* |
| Ga0134122_103378271 | 3300010400 | Terrestrial Soil | RRGLKRDMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDQALAKWAAKSAKSK* |
| Ga0137391_101375233 | 3300011270 | Vadose Zone Soil | MRCHYPGCKNRSKGPRFRFLCEQHLKLPKREQDAALAKWAEKNA* |
| Ga0137393_100657053 | 3300011271 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFKFLCDEHRKLPKKEQDAALEKWAQKNG* |
| Ga0137393_109833402 | 3300011271 | Vadose Zone Soil | MRCRYPGCKNKSKGPRFRFLCEEHRKLPKKAQDEALAKWAKKNA* |
| Ga0137388_106070912 | 3300012189 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKAAEKNG* |
| Ga0137363_102483811 | 3300012202 | Vadose Zone Soil | MSCRYPGCKNQSKGPRFRFFCEKHIKLPKKEQEAALAKWAEKRR* |
| Ga0137399_102997501 | 3300012203 | Vadose Zone Soil | KNRSKGPRFRFLCEEHLKLPKRKQDEVLAKAARKSA* |
| Ga0137399_111524471 | 3300012203 | Vadose Zone Soil | PGCKNRSKGPRFRFLCEEHLNLPKKKRDEVLAKSATKRA* |
| Ga0137362_100144108 | 3300012205 | Vadose Zone Soil | MSSRYQGCKNRSKGPRFRFFCEKHVKLPKKEQESALAKWAEKRRVS* |
| Ga0137362_105508372 | 3300012205 | Vadose Zone Soil | LNKRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWADKNA* |
| Ga0137362_106537402 | 3300012205 | Vadose Zone Soil | CKNRSKGPRFRFFCEKHMKLPRKKQEAALAKWAEKSSRRE* |
| Ga0137376_112152852 | 3300012208 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKRKQDEVLAKWAEKTG* |
| Ga0137360_106234932 | 3300012361 | Vadose Zone Soil | HYPGCKNRSKGPRFRFLCEEHLKLPKKEQDAALTKWAEKNAAS* |
| Ga0137360_109589281 | 3300012361 | Vadose Zone Soil | LNKRYPGCKNRSKGPRFRFLCEEHLKLPKKRQDEVLAKWADKNA* |
| Ga0137358_100139594 | 3300012582 | Vadose Zone Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKQEAALAK* |
| Ga0137397_100108237 | 3300012685 | Vadose Zone Soil | MRCRYPGCKNKSKGPRFKFFCEEHRNLPKKEQDAALSKWAEKNG* |
| Ga0137397_100588222 | 3300012685 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFFCEKHTKLSKKEQEAALAKWAKKSSRRE* |
| Ga0137395_110582921 | 3300012917 | Vadose Zone Soil | DMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNP* |
| Ga0137396_100166431 | 3300012918 | Vadose Zone Soil | CKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNT* |
| Ga0137396_100683362 | 3300012918 | Vadose Zone Soil | MRCRFPGCKNRSKGPRFRFLCEQHLKLPKKKQEEVVAKWAEKNG* |
| Ga0137396_103824413 | 3300012918 | Vadose Zone Soil | VSKKVGSLKRDMSCRYPDCKNRSKGPRFRFLCEEHLKLPKKKQDELLAKWAEKEA* |
| Ga0137396_107726391 | 3300012918 | Vadose Zone Soil | RSTRAGSSKRDMSCRYPGCKNRSKGPRFRFLCEEHLKLPEKKQDEVLAKWAENSA* |
| Ga0137394_100124937 | 3300012922 | Vadose Zone Soil | CHYPRCKNRSKGPRFRFLCAEHLKLPKQEQDTALAKWADKNAAP* |
| Ga0137394_102213371 | 3300012922 | Vadose Zone Soil | RDMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKNQEAALAKWAEKNA* |
| Ga0137404_100016187 | 3300012929 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFFCEEHLKLPKKKQDEVLAKAAEKNG* |
| Ga0137404_113273841 | 3300012929 | Vadose Zone Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAQKTG* |
| Ga0137407_100122774 | 3300012930 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFFCEKHMKLPRKKQEAALAKWAEKSSRRE* |
| Ga0137407_106199491 | 3300012930 | Vadose Zone Soil | PGCKNRSKGPRFRFLCEEHLKLPKKKQEEVLAKWAEKNA* |
| Ga0137410_109920671 | 3300012944 | Vadose Zone Soil | DMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDDVLAKAAEKNG* |
| Ga0137410_110977732 | 3300012944 | Vadose Zone Soil | MHCRYPGCKNRSKGPRFRFFCEEHLKLPKKEQDVALAKWAEKNA* |
| Ga0137420_10897822 | 3300015054 | Vadose Zone Soil | RKRDMHCRYPGCKNRSKGPRFRFFCEKHMKLPRKKQEAALAKWAAKSSRRE* |
| Ga0137420_13711843 | 3300015054 | Vadose Zone Soil | MSCRYPGCKRRSKGPRFRFLCEEHLKLPKKKQDEVLAKRAKKNA* |
| Ga0066655_109438322 | 3300018431 | Grasslands Soil | SSKRDMSCRYPGCKDRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAGKTSRLT |
| Ga0066667_112441782 | 3300018433 | Grasslands Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAERNS |
| Ga0066662_100366912 | 3300018468 | Grasslands Soil | MRCRYPGCKNRSKGPRFRFFCEEHLKLPKKQQDAALVKWAAKNA |
| Ga0137408_14512263 | 3300019789 | Vadose Zone Soil | MSCRYPGCKNRSKGPRFAFFCEKHFKLPATQKAKALTAWKEKKAAE |
| Ga0179594_100061772 | 3300020170 | Vadose Zone Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKQEAALAK |
| Ga0137417_12276642 | 3300024330 | Vadose Zone Soil | MSCRYPGCTNRSKGPRFRFLCEKHLKLPRKKQDEVLAKWAEKNE |
| Ga0209234_10257681 | 3300026295 | Grasslands Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAK |
| Ga0209235_10546764 | 3300026296 | Grasslands Soil | RYPGCKNRSKGPRFRFLCEEHLKLPKKKQDAALAKWAEKNS |
| Ga0209237_10846891 | 3300026297 | Grasslands Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKEQGAALAKWA |
| Ga0209055_10444082 | 3300026309 | Soil | MRCRYPGCKNRSKGPRFRFFCEEHLKLPKKEQDAALVKWAAKNP |
| Ga0209687_10258113 | 3300026322 | Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNA |
| Ga0209267_10462482 | 3300026331 | Soil | MRCRYPGCKNRSKGPRFRFFCEEHLKLPKKEQDAALVKWAAKNA |
| Ga0209267_12855201 | 3300026331 | Soil | DMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNA |
| Ga0209158_12515071 | 3300026333 | Soil | KNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNG |
| Ga0257179_10575082 | 3300026371 | Soil | MRCRFPGCKNRSKGPRFRFLCEQHLKLPKKKQEEVVAKWAEKNG |
| Ga0209059_11128442 | 3300026527 | Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEILAKWAEKNP |
| Ga0209806_10790543 | 3300026529 | Soil | PGCKNRSKGPRFRFFCEEHLKLPKKEQDAALVKWAAKNA |
| Ga0209805_10634072 | 3300026542 | Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKEQGAALAKWAEKNA |
| Ga0209076_10377731 | 3300027643 | Vadose Zone Soil | CVGDMSCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNT |
| Ga0209388_10366171 | 3300027655 | Vadose Zone Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDAVLAKWAEKIG |
| Ga0208990_10071583 | 3300027663 | Forest Soil | MRCRYPGCKNRSKGPRFRFFCEKHIKLPKKEQEAVLAKWAEKSSRSHPA |
| Ga0209009_11796712 | 3300027667 | Forest Soil | VFSRYPGCKNRSKGPRFRFLCEEHLRLPKKKQDEVLAKWAEKNT |
| Ga0209011_10168773 | 3300027678 | Forest Soil | MRCRYAGCKNRSKGPRFRFFCEKHMKLPKKKQDEMTAKWAAKNAKRE |
| Ga0209689_10067981 | 3300027748 | Soil | RKAGSLKRDMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEILAKWAEKNP |
| Ga0209689_100714714 | 3300027748 | Soil | RKAGSLKRDMSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNG |
| Ga0209180_10000002120 | 3300027846 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKWAEKNT |
| Ga0209180_1000004757 | 3300027846 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCEEHLKLPRKKQDEVLAKWAEKNA |
| Ga0209180_100141185 | 3300027846 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCDEHRKLPKKEQEAALAKWAEKNA |
| Ga0209180_103574331 | 3300027846 | Vadose Zone Soil | MRCRYPGCKNRSKGPRFRFLCDEHRKLPKKKQEAALAHWAKT |
| Ga0209283_100160834 | 3300027875 | Vadose Zone Soil | MRCRYPGCKNKSKGPRFRYLCEEHLKLPKKKQDEVLAKAAEKNT |
| Ga0209590_106506501 | 3300027882 | Vadose Zone Soil | PGCKNRSKGPRFRFLCEEHLNLPRKEQDAALTKWAEKLNRGGP |
| Ga0209698_113345431 | 3300027911 | Watersheds | RYPGCKNKSKGPRFRFMCEEHRKLPRADQAAALEKWARKHG |
| Ga0137415_100518593 | 3300028536 | Vadose Zone Soil | MSCRYPGCKNRSKGPRFRFFCEKHLKLPKKEQQAALAKWAEKGR |
| Ga0137415_102496311 | 3300028536 | Vadose Zone Soil | MRCRYPGCKNRSKRPLFPFFCEKHLKLPKKKQEAALAKWAKKRRSNA |
| Ga0307472_1024147162 | 3300032205 | Hardwood Forest Soil | GCKNRSKGPRFRYFCDEHLKLPKKEQEAALVKWAEKNG |
| Ga0335085_100097504 | 3300032770 | Soil | MSCRYPGCKNRSKGPRFRFLCEEHLKLPKKKQDEVLAKAAEKNA |
| ⦗Top⦘ |